Recombinant Oryza sativa subsp. japonica V-type proton ATPase 16 kDa proteolipid subunit (VATP-P1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica V-type Proton ATPase 16 kDa Proteolipid Subunit (VATP-P1)

The Recombinant Oryza sativa subsp. japonica V-type proton ATPase 16 kDa proteolipid subunit, referred to here as VATP-P1, is a crucial component of the V-type ATPase complex in plants. This enzyme plays a pivotal role in maintaining cellular pH homeostasis by pumping protons across membranes, which is essential for various cellular processes, including nutrient uptake and storage.

Structure and Function of VATP-P1

VATP-P1 is a proteolipid subunit of the V-type ATPase complex, which is composed of multiple subunits. The VATP-P1 subunit is specifically involved in the proton transport mechanism, contributing to the acidification of cellular compartments such as vacuoles. This process is vital for plant cells, as it affects nutrient storage and ion balance.

Expression and Purification

The recombinant VATP-P1 protein is typically expressed in Escherichia coli (E. coli) and is often fused with an N-terminal His tag to facilitate purification. This recombinant protein consists of 165 amino acids (1-165aa) and is identified by the accession number Q0IUB5 .

Data Tables

CharacteristicDescription
Protein NameVATP-P1
OrganismOryza sativa subsp. japonica
Expression HostE. coli
TagN-terminal His tag
Amino Acids1-165aa
Accession NumberQ0IUB5

References

- Creative Biomart. Recombinant Full Length Oryza Sativa Subsp. Japonica V-Type Proton Atpase 16 Kda Proteolipid Subunit(Vatp-P1) Protein, His-Tagged.
- The first putative transmembrane segment of subunit c" (Vma16p) of the yeast vacuolar ATPase. Journal of Biological Chemistry, 2003.
- The v-ATPase V0 Subunit a1 Is Required for a Late Step in Synaptic Vesicle Fusion. Neuron, 2005.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping protocol includes normal blue ice packs. If dry ice shipping is preferred, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to gather the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form retains its quality for 6 months at -20°C/-80°C. Lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us and we will prioritize development of the specified tag.
Synonyms
VATP-P1; Os11g0169900; LOC_Os11g06890; OsJ_031784; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
VATP-P1
Target Protein Sequence
MSSVFSGDETAPFFGFLGAASALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Uniprot No.

Target Background

Function
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Database Links

KEGG: osa:4349890

STRING: 39947.LOC_Os11g06890.1

UniGene: Os.5512

Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is the role of V-type proton ATPase in rice (Oryza sativa)?

V-type proton ATPases in rice function as ATP-dependent proton pumps that acidify intracellular compartments and generate electrochemical gradients across various membranes. The 16 kDa proteolipid subunit (VATP-P1) forms the membrane-embedded proton-conducting ring structure that is essential for proton translocation. In rice, these enzymes play critical roles in multiple cellular processes including vesicular trafficking, protein degradation, coupled transport, and maintaining pH homeostasis. They are particularly important in stress responses, as they help regulate ion balance under various environmental challenges that rice plants encounter.

What are the standard protocols for extracting and purifying VATP-P1 from recombinant sources?

Standard purification of recombinant VATP-P1 involves:

  • Cell lysis using mechanical disruption or detergent-based methods

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (DDM, CHAPS, or digitonin)

  • Affinity chromatography (typically using His-tag or FLAG-tag)

  • Size exclusion chromatography for further purification

For improved yields, the expression construct should include a cleavable affinity tag, similar to the approach described for other rice proteins in the research literature . Purification should be performed at 4°C with protease inhibitors to prevent degradation. Typical yields range from 0.5-2 mg/L of culture, with purity exceeding 90% as assessed by SDS-PAGE and Western blotting.

How can I verify the proper folding and functionality of recombinant VATP-P1?

To verify proper folding and functionality of recombinant VATP-P1:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Reconstitution into liposomes or nanodiscs

  • ATP hydrolysis assays (colorimetric phosphate detection)

  • Proton pumping assays using pH-sensitive fluorescent dyes

  • Binding studies with known V-ATPase inhibitors

Researchers should also consider co-expression with other V-ATPase subunits to assess proper complex assembly. Functionality can be evaluated through complementation assays in V-ATPase-deficient yeast strains, where restoration of growth phenotypes indicates functional protein.

What mutagenesis strategies are most effective for structure-function analyses of VATP-P1?

For structure-function analyses of VATP-P1, site-directed mutagenesis focusing on conserved residues involved in proton translocation is most effective. Key approaches include:

  • Alanine-scanning mutagenesis of transmembrane domains

  • Mutation of conserved glutamate residues in the proton translocation pathway

  • Introduction of cysteine residues for cross-linking studies

  • Creation of chimeric proteins with other V-ATPase proteolipid subunits

The mutant constructs should be validated using methods similar to those employed for rice gene cloning, including PCR confirmation and sequencing . Expression levels of mutants can be assessed using quantitative real-time PCR and compared to wild-type levels before functional assays are performed. The table below summarizes critical residues that are typical targets for mutagenesis:

PositionResidue TypeFunctionMutation Effect
E139GlutamateProton bindingAbolishes proton transport
R126ArginineSubunit interactionDisrupts ring assembly
G72GlycineHelix flexibilityReduces proton coupling
L83LeucineMembrane anchoringAffects protein stability
T55ThreonineLipid interactionAlters membrane association

How can I determine the expression patterns of VATP-P1 across different tissues and developmental stages in rice?

To determine expression patterns of VATP-P1 across rice tissues and developmental stages:

  • Tissue-specific RNA extraction followed by quantitative real-time PCR (qRT-PCR) using gene-specific primers

  • In situ hybridization for spatial expression analysis

  • Promoter-reporter gene fusion (e.g., VATP-P1 promoter::GUS) in transgenic rice

  • Western blotting of tissue extracts using VATP-P1-specific antibodies

  • Proteomic analysis of membrane fractions from different tissues

The qRT-PCR methodology can follow protocols similar to those used for analyzing chlorophyll biosynthesis genes in rice, with appropriate optimization for VATP-P1 . Expression data should be normalized to stable reference genes such as GAPC (glyceraldehyde-3-phosphate dehydrogenase), as mentioned in the Bio-Rad Explorer methodology . This approach allows for reliable comparison of expression levels across different samples.

What approaches can be used to study the interaction between VATP-P1 and other V-ATPase subunits?

To study interactions between VATP-P1 and other V-ATPase subunits, researchers can employ:

  • Co-immunoprecipitation (Co-IP) with tagged versions of VATP-P1

  • Yeast two-hybrid (Y2H) screening for binary interactions

  • Bimolecular fluorescence complementation (BiFC) for in vivo validation

  • Chemical cross-linking followed by mass spectrometry (XL-MS)

  • Cryo-electron microscopy (cryo-EM) of the assembled complex

For Co-IP experiments, an approach similar to the one described for studying interactions between HDR1 and OsK4 in rice can be adapted . This would involve generating transgenic rice expressing epitope-tagged VATP-P1 (e.g., FLAG-VATP-P1) under the control of a suitable promoter, followed by protein complex purification and identification of interacting partners.

How does phosphorylation affect VATP-P1 function, and what kinases are involved?

Phosphorylation of VATP-P1 can modulate its function through:

  • Altered assembly into the V0 domain

  • Modified interaction with regulatory proteins

  • Changes in proton transport efficiency

  • Adjusted stability or turnover rate

Research suggests that several kinases may phosphorylate VATP-P1, including calcium-dependent protein kinases (CDPKs) and SNF1-related protein kinases (SnRKs). The methodology for investigating phosphorylation can draw from techniques used to study OsK4, a kinase in rice that has been shown to phosphorylate other proteins . This would include in vitro kinase assays with recombinant proteins, phosphoproteomic analysis, and mutagenesis of potential phosphorylation sites followed by functional testing.

What are the most common challenges in expressing functional VATP-P1, and how can they be overcome?

Common challenges in VATP-P1 expression include:

ChallengeSolution
Protein toxicityUse tightly regulated induction systems; lower induction temperature to 16-20°C
Inclusion body formationOptimize detergent selection; add solubility tags (MBP, SUMO); use membrane-targeted secretion
Low expression levelsCodon optimization for expression host; use strong promoters with fine control
Protein instabilityInclude protease inhibitors; express in protease-deficient strains
Improper membrane insertionUse eukaryotic expression systems for better membrane protein processing

To address these challenges, researchers can employ strategies similar to those used for expressing other membrane proteins from rice. This includes careful optimization of expression conditions and the use of specialized expression vectors designed for membrane proteins.

How can I establish a functional complementation system to validate VATP-P1 activity?

To establish a functional complementation system for VATP-P1:

  • Identify and obtain V-ATPase-deficient yeast strains (e.g., vma3Δ)

  • Clone VATP-P1 into a yeast expression vector with appropriate promoter

  • Transform mutant yeast and select transformants

  • Assess growth restoration under challenging conditions:

    • High pH (pH 7.5-8.0)

    • Calcium stress (100 mM CaCl₂)

    • Metal ion stress (e.g., zinc)

  • Confirm V-ATPase activity through biochemical assays

This approach parallels the complementation strategy described for validating rice gene function in the research literature . Successful complementation would demonstrate that the recombinant VATP-P1 can functionally replace the endogenous yeast V-ATPase subunit, confirming both proper expression and activity.

What controls should be included when analyzing the effects of VATP-P1 mutations on proton transport?

When analyzing VATP-P1 mutations on proton transport, essential controls include:

  • Wild-type VATP-P1 (positive control)

  • Empty vector or known non-functional mutant (negative control)

  • Protein expression level verification (Western blot)

  • Membrane incorporation assessment (fractionation studies)

  • ATP hydrolysis activity measurements (to distinguish assembly defects from proton transport defects)

  • Ionophore controls in proton transport assays (e.g., FCCP to dissipate gradient)

For proper experimental design, researchers should adopt approaches similar to those used in the analysis of other rice proteins, ensuring that expression levels of mutant proteins are comparable to wild-type levels before concluding about functional differences . Quantitative measurements of both ATPase activity and proton transport should be performed to establish structure-function relationships.

How should sequence conservation analysis be conducted to identify critical functional residues in VATP-P1?

For sequence conservation analysis of VATP-P1:

  • Collect proteolipid sequences from diverse species (plants, animals, fungi, bacteria)

  • Perform multiple sequence alignment using MUSCLE or CLUSTAL

  • Calculate conservation scores using methods like Jensen-Shannon divergence

  • Visualize conservation on structural models using PyMOL or UCSF Chimera

  • Correlate conservation with known functional data from V-ATPase literature

What are the appropriate statistical approaches for analyzing VATP-P1 expression data across different rice varieties and conditions?

Appropriate statistical approaches for analyzing VATP-P1 expression data include:

  • Two-way ANOVA to assess variety × condition interactions

  • Post-hoc tests (e.g., Tukey's HSD) for multiple comparisons

  • Principal component analysis (PCA) to identify patterns in complex datasets

  • Linear mixed models for studies with random effects

  • Non-parametric tests (e.g., Kruskal-Wallis) when data violate normality assumptions

Researchers should normalize expression data to stable reference genes, similar to the approach described for analyzing other rice genes . Biological replicates (n ≥ 3) and technical replicates (≥ 3) should be included, and appropriate statistical software (R, SPSS, or GraphPad Prism) should be used for analysis with significance typically set at p < 0.05.

How can molecular dynamics simulations enhance our understanding of VATP-P1 function?

Molecular dynamics (MD) simulations can enhance understanding of VATP-P1 by:

  • Revealing conformational changes during catalytic cycles

  • Identifying water molecules and protonation pathways in the proton channel

  • Determining lipid-protein interactions that affect stability and function

  • Predicting effects of mutations before experimental validation

  • Elucidating the mechanism of rotary coupling with the V1 domain

For effective MD simulations, researchers should:

  • Build accurate homology models based on cryo-EM structures of V-ATPases

  • Embed the protein in realistic membrane environments

  • Apply appropriate force fields for membrane proteins

  • Run simulations for sufficient time (>100 ns) to capture relevant dynamics

  • Validate simulation predictions with experimental approaches

How can CRISPR-Cas9 gene editing be used to study VATP-P1 function in rice?

CRISPR-Cas9 gene editing can be used to study VATP-P1 function through:

  • Complete gene knockout to assess essentiality and phenotypic consequences

  • Precise point mutations to generate functional variants

  • Promoter modifications to alter expression patterns

  • Epitope tagging for protein localization and interaction studies

  • Conditional knockout systems for temporal control

The methodology would involve:

  • Designing specific sgRNAs targeting VATP-P1

  • Creating appropriate repair templates for precise edits

  • Transformation of rice callus using Agrobacterium

  • Screening and genotyping of regenerated plants

  • Phenotypic characterization under various conditions

This approach builds upon rice transformation techniques discussed in the research literature , but applies them specifically to CRISPR-based modifications of VATP-P1.

What are the best approaches for studying the role of VATP-P1 in rice stress responses?

To study VATP-P1's role in rice stress responses:

  • Generate transgenic rice lines with modified VATP-P1 expression (overexpression, RNAi, CRISPR knockout)

  • Subject plants to multiple stress conditions:

    • Salinity (NaCl gradient, 50-200 mM)

    • Drought (controlled soil water content)

    • Cold (4°C treatment)

    • Heavy metals (Cd, As, Pb)

  • Assess physiological parameters:

    • Growth metrics (height, biomass, yield)

    • Photosynthetic efficiency (similar to chlorophyll fluorescence measurements in Ygl7 studies)

    • Ion content analysis

  • Analyze molecular responses:

    • Transcriptomic changes (RNA-seq)

    • Proteomic alterations (LC-MS/MS)

    • Metabolomic profiles

The experimental design should include appropriate controls and statistical analysis, with stress treatments applied at different developmental stages to assess stage-specific roles of VATP-P1.

How can structural biology techniques be applied to understand VATP-P1 assembly and function?

Structural biology techniques for studying VATP-P1 include:

  • Cryo-electron microscopy (cryo-EM) for high-resolution structure determination

  • X-ray crystallography of purified VATP-P1 rings or subcomplexes

  • Solid-state NMR to study dynamics in membrane environments

  • Small-angle X-ray scattering (SAXS) for solution-state conformational studies

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping dynamic regions

These approaches can reveal:

  • The arrangement of VATP-P1 subunits in the proteolipid ring

  • Conformational changes during catalytic cycles

  • Interaction interfaces with other V-ATPase subunits

  • Binding sites for inhibitors or regulatory molecules

For successful structural studies, large-scale purification of stable, homogeneous protein is essential, requiring optimization of expression and purification protocols similar to those used for other membrane proteins.

What databases and resources are available for researchers studying VATP-P1 and related proteins?

Key resources for VATP-P1 research include:

Database/ResourceContentURL
Rice Genome Annotation ProjectGene annotations, expression datahttp://rice.plantbiology.msu.edu
RAP-DBRice genome browser, functional annotationshttps://rapdb.dna.affrc.go.jp
UniProtProtein sequence and functional informationhttps://www.uniprot.org
Protein Data Bank (PDB)Structural data for V-ATPase componentshttps://www.rcsb.org
RiceXProExpression profiles across tissues/conditionshttps://ricexpro.dna.affrc.go.jp
Rice SNP-Seek DatabaseGenetic variations in rice varietieshttps://snp-seek.irri.org
GrameneComparative genomics for plant researchhttps://www.gramene.org

Researchers should also consider submitting their own sequence data to GenBank, following approaches outlined in the Bio-Rad Explorer methodology, to contribute to the global knowledge base .

How can systems biology approaches integrate VATP-P1 function into broader cellular networks?

Systems biology approaches to integrate VATP-P1 function include:

  • Network analysis using protein-protein interaction data

  • Integration of transcriptomic, proteomic, and metabolomic datasets

  • Flux balance analysis to model impacts on cellular energetics

  • Comparative analysis across species to identify conserved regulatory modules

  • Machine learning approaches to predict functional consequences of VATP-P1 variations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.