Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter 1.2 (VIT1.2)

Shipped with Ice Packs
In Stock

Description

Biological Role in Iron Homeostasis

VIT1.2 regulates iron distribution in rice tissues, with critical functions:

  • Vacuolar Iron Storage: Transports cytosolic iron into vacuoles, preventing oxidative stress under excess iron conditions .

  • Seed Development: Essential for iron allocation during embryogenesis and seedling growth .

  • Interaction Network: Partners with glutamate synthases (e.g., GLT1_ORYSJ) and cation transporters (e.g., CCC1) to balance nutrient dynamics .

Key Findings from Functional Studies

  • Iron Toxicity Tolerance: OsVIT2 (VIT1.2) knockout lines exhibit reduced iron accumulation in flag leaves, enhancing sensitivity to iron overload .

  • Biofortification Potential: Overexpression of VIT homologs in crops increases iron content in edible parts, offering a strategy to combat dietary iron deficiency .

Production and Applications

Recombinant VIT1.2 is produced in multiple systems:

Expression SystemAdvantagesYield
E. coliCost-effective, high scalability0.1–1.0 mg/mL
YeastPost-translational modificationsInquire
BaculovirusEukaryotic folding for functional assaysInquire

Applications:

  • Agricultural Biotechnology: Engineered rice lines with modulated VIT1.2 activity show promise for iron-enriched grains .

  • Drug Target Exploration: Structural insights aid in designing inhibitors against parasitic VIT homologs (e.g., Plasmodium falciparum) .

Research Challenges and Future Directions

  • Mechanistic Gaps: The exact iron-binding residues and regulatory pathways remain undefined .

  • Biotechnological Optimization: Improving recombinant yields in eukaryotic systems (e.g., rice seeds) for large-scale applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
VIT2; Os09g0396900; LOC_Os09g23300; OJ1655_B12.5; OsJ_29262; Vacuolar iron transporter 2; OsVIT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
VIT1.2
Target Protein Sequence
MVKEFVQDEEKQRLLLDEHTEKHFTAGEVVRDIIIGVSDGLTVPFALAAGLSGANAPSAL VLTAGLAEVAAGAISMGLGGYLAAKSDADHYHRELQREQEEIDTVPDTEAAEIADILSQY GLGPEEYGPVVNSLRSNPKAWLEFMMKFELGLEKPEPRRALMSAGTIALAYVVGGLVPLL PYMFVPTADRAMATSVVVTLAALLFFGYVKGRFTGNRPFISAFQTAVIGALASAAAFGMA KAVQSI
Uniprot No.

Target Background

Function
Vacuolar iron transporter 1.2 (VIT1.2) from *Oryza sativa* subsp. *japonica* is involved in transporting iron ions from the cytosol to the vacuole for intracellular storage. This vacuolar iron storage is crucial for seed embryo and seedling development and may also play a role in regulating iron translocation between flag leaves and seeds. VIT1.2 can also transport zinc ions from the cytosol to the vacuole.
Database Links

KEGG: osa:4346978

STRING: 39947.LOC_Os09g23300.1

UniGene: Os.9660

Protein Families
CCC1 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaf sheaths and at lower level in leaf blades.

Q&A

What is the Vacuolar Iron Transporter (VIT) in rice and what is its primary function?

The Vacuolar Iron Transporter (VIT) in rice (Oryza sativa subsp. japonica) functions as a critical component in iron homeostasis by sequestering excess iron into vacuoles. Rice contains two homologous genes - OsVIT1 and OsVIT2 - which are particularly highly expressed in the flag leaf blade (OsVIT1) and leaf sheath (both OsVIT1 and OsVIT2) . The primary function of these transporters is to regulate iron distribution within the plant, protecting cells from iron toxicity while ensuring proper iron allocation to various tissues. OsVIT2 specifically plays a key role in controlling iron distribution to rice grains by sequestering iron into vacuoles within the mestome sheath, nodes, and aleurone layer of the seed . This sequestration mechanism influences the ultimate iron content of both polished and unpolished rice grains, making VITs important targets for biofortification research.

What is the molecular structure and key domains of rice VIT proteins?

Rice VIT proteins possess a distinctive molecular structure with conserved domains that are crucial for their iron transport function. Analysis of the amino acid sequence reveals that rice VIT1 contains 232 amino acids with specific functional motifs . The protein includes several transmembrane domains that facilitate iron transport across the vacuolar membrane.

The sequence of VIT1 begins with "MAIDLGCHVGCASPETKQEETADPTAAPVVVDDVEAAAGGRR..." and contains important conserved residues that are essential for iron binding and transport . VIT proteins share structural similarities with VITs from other plant species like Arabidopsis thaliana, where key residues such as D43 and M80 are essential for iron binding . This conservation across species highlights the evolutionary importance of these transporters in plant iron homeostasis. The protein's structure facilitates its localization to the tonoplast (vacuolar membrane), where it functions to transport iron from the cytoplasm into the vacuole.

How is recombinant VIT protein properly stored and handled in laboratory settings?

For optimal stability and activity of recombinant Oryza sativa VIT proteins, proper storage and handling protocols are essential. Recombinant VIT proteins are typically supplied in a Tris-based buffer containing 50% glycerol, specifically optimized for protein stability . The recommended storage temperature is -20°C for routine use, while -80°C is advised for extended storage periods .

To maintain protein integrity during experimental workflows, researchers should avoid repeated freeze-thaw cycles, which can significantly compromise protein structure and function . When planning experiments requiring multiple uses of the protein, it is advisable to prepare smaller working aliquots that can be stored at 4°C for up to one week . This approach minimizes freeze-thaw damage while ensuring convenient access to the protein for ongoing experiments. When thawing frozen stocks, use gentle thawing methods at controlled temperatures rather than rapid warming to preserve protein structure and activity.

What are the optimal experimental designs for studying VIT function in rice iron homeostasis?

When designing experiments to investigate VIT function in rice iron homeostasis, researchers should implement a comprehensive approach incorporating multiple techniques and controlled variables. Begin with a characterizing experimental design that systematically identifies factors affecting iron transport and distribution . This requires careful selection of response variables, such as tissue-specific iron concentration measurements and phenotypic assessments.

An effective experimental design should include:

  • Genetic manipulation approaches: Generate knockout, knockdown, and overexpression lines of VIT genes using CRISPR-Cas9 or RNAi techniques to analyze phenotypic effects and iron distribution patterns. Compare mutant phenotypes with wild-type plants under various iron conditions.

  • Tissue-specific expression analysis: Employ techniques such as qRT-PCR to monitor VIT expression across different plant tissues and developmental stages. This should be complemented with RNA-seq analysis to identify co-regulated genes involved in iron homeostasis networks .

  • Controlled growth conditions: Maintain strict control over nutrient availability, particularly iron concentrations, while accounting for other variables such as humidity, temperature, and light intensity. Include treatment groups with varying iron availability (deficient, sufficient, excess) to assess VIT's role under different stress conditions.

  • Comprehensive iron distribution analysis: Utilize techniques like Perls' staining, synchrotron X-ray fluorescence (SXRF), or inductively coupled plasma mass spectrometry (ICP-MS) to map iron distribution across tissues with high spatial resolution, particularly focusing on nodes, leaf sheaths, and developing grains where VIT shows high expression .

  • Subcellular localization studies: Employ fluorescent protein tagging and confocal microscopy to confirm vacuolar localization and potentially identify any dynamic trafficking of VIT proteins in response to changing iron status.

How can researchers effectively produce and purify recombinant VIT proteins for functional studies?

Producing high-quality recombinant VIT proteins for functional studies requires a systematic approach optimized for membrane proteins. Begin by selecting an appropriate expression system; while E. coli is commonly used for initial trials, eukaryotic systems like yeast or insect cells often yield better results for plant membrane proteins such as VIT. The coding sequence should be codon-optimized for the chosen expression system and cloned into a vector containing suitable purification tags.

For optimal expression and purification:

  • Vector design considerations: Include a cleavable affinity tag (His6, GST, or FLAG) to facilitate purification while allowing tag removal for functional studies. Consider using a fusion partner that enhances solubility.

  • Expression optimization: Test multiple expression conditions (temperature, induction time, inducer concentration) to maximize protein yield while maintaining proper folding. For VIT proteins, lower expression temperatures (15-20°C) often improve proper folding.

  • Membrane protein extraction: Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that effectively solubilize membrane proteins while preserving structure and function. Optimize detergent concentration through small-scale extractions.

  • Purification strategy: Implement a multi-step purification process, beginning with affinity chromatography based on the chosen tag, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations. Monitor protein quality at each step using SDS-PAGE and Western blotting.

  • Quality assessment: Verify protein folding and stability using circular dichroism spectroscopy and thermal shift assays. Confirm protein functionality through in vitro transport assays using liposome reconstitution systems.

  • Storage conditions: Store the purified protein in a Tris-based buffer containing 50% glycerol at -20°C or -80°C to maintain stability .

What analytical techniques are most effective for measuring iron transport activity of VIT in vitro?

Assessing the iron transport activity of recombinant VIT proteins in vitro requires sophisticated analytical techniques that can directly measure iron movement across membranes. Several complementary approaches can be employed:

  • Liposome-based transport assays: Reconstitute purified VIT proteins into liposomes and measure iron uptake using:

    • Radiolabeled iron (55Fe) to track transport kinetics with high sensitivity

    • Fluorescent iron chelators that change emission properties upon iron binding

    • Direct ICP-MS measurement of iron content inside liposomes after separation from the external medium

  • Yeast complementation assays: Utilize Δccc1 yeast strains (lacking the yeast VIT homolog) to assess functional complementation by rice VIT genes . This approach leverages the iron hypersensitivity of these mutants, with restoration of growth in high-iron media indicating functional transport activity.

  • Patch-clamp electrophysiology: For detailed biophysical characterization, employ patch-clamp techniques on vacuolar membrane patches or VIT-reconstituted giant liposomes to measure iron-dependent currents and determine transport kinetics.

  • Iron-binding assays: Assess the direct interaction between VIT and iron using:

    • Isothermal titration calorimetry (ITC) to determine binding affinities

    • Microscale thermophoresis (MST) for analyzing interactions with minimal protein consumption

    • Structural studies through X-ray crystallography or cryo-EM focusing on the conserved iron-binding residues (such as D43 and M80 homologs)

  • Competitive inhibition studies: Use known inhibitors of iron transport to characterize the specificity of VIT activity and identify key regulatory mechanisms.

Data integration across these different methodologies provides comprehensive insights into VIT transport mechanisms, substrate specificity, and kinetic parameters.

How does OsVIT function differ between various rice tissues and developmental stages?

The function of OsVIT transporters exhibits significant tissue-specificity and developmental regulation throughout the rice life cycle. In mature rice plants, OsVIT1 shows predominant expression in the flag leaf blade, while both OsVIT1 and OsVIT2 are highly expressed in the leaf sheath . This differential expression reflects specialized roles in iron mobilization during vegetative growth versus reproductive development.

OsVIT2 demonstrates particularly notable tissue-specific expression patterns:

  • Strong expression in the parenchyma cell bridges of nodes

  • High activity in the mestome sheath of leaf sheaths

  • Significant presence in the aleurone layer of developing caryopsis (grain)

This expression profile correlates with OsVIT2's function in controlling iron distribution to developing grains. During the reproductive phase, OsVIT2 activity in nodes becomes especially critical, as nodes serve as the hub for mineral nutrient distribution to reproductive tissues. The presence of OsVIT2 in these specific tissues creates iron repositories that influence the plant's response to varying iron conditions and affect the ultimate iron content of harvested grains.

Developmental timing also influences VIT function, with expression patterns shifting during senescence to facilitate nutrient remobilization from vegetative to reproductive tissues. This dynamic regulation ensures optimal iron allocation based on the plant's changing needs throughout its life cycle, balancing between immediate metabolic requirements and storage for future reproductive success.

What is the relationship between VIT function and iron biofortification strategies in rice?

VIT function has direct implications for iron biofortification strategies in rice, primarily through its role in controlling iron sequestration versus mobilization. Studies have demonstrated that knockout of OsVIT2 results in a significant redistribution of iron within the rice plant, with decreased iron in leaf sheaths, nodes, and aleurone layers, but increased iron in leaf blades and - most importantly for biofortification purposes - in the grain endosperm .

The biofortification potential of VIT manipulation is particularly promising because:

  • OsVIT2 knockout increases iron accumulation specifically in the polished rice grain (endosperm) without negatively affecting yield parameters . This is crucial for practical biofortification, as most consumers prefer polished rice where the iron-rich aleurone layer has been removed.

  • The iron increase occurs without disrupting essential agronomic traits, suggesting VIT-targeted biofortification can avoid the yield penalties often associated with other biofortification approaches.

  • The mechanism works by redirecting iron already within the plant rather than requiring increased iron uptake from soil, making it potentially more environmentally sustainable and effective across different growing conditions.

For applied biofortification programs, researchers can employ several strategies involving VIT:

  • Conventional breeding focusing on natural allelic variations in VIT genes

  • Precision gene editing of VIT to modify expression or function

  • Promoter modifications to alter tissue-specific expression patterns

  • Combined approaches targeting multiple iron homeostasis genes including VIT, ferritin, and iron transporters

These approaches must be balanced against potential unintended consequences, such as altered stress responses or reduced iron stores for early seedling establishment.

How can researchers investigate potential interactions between VIT and other iron homeostasis proteins?

Investigating interactions between VIT and other iron homeostasis proteins requires a multi-faceted approach integrating molecular, biochemical, and genetic techniques. Several methodological strategies can effectively elucidate these complex interactions:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation (Co-IP) assays using antibodies against VIT to identify interacting partners

    • Yeast two-hybrid (Y2H) screening with VIT as bait to discover direct protein interactions

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

    • Proximity-dependent biotin identification (BioID) to capture even transient interactions within the cellular environment

  • Transcriptional network analysis:

    • RNA-seq of VIT mutants compared to wild-type plants to identify co-regulated genes

    • ChIP-seq to identify transcription factors that regulate VIT expression

    • Promoter analysis to identify binding sites for iron-responsive transcription factors

  • Genetic interaction studies:

    • Creation of double/triple mutants combining VIT mutations with mutations in other iron homeostasis genes

    • Suppressor/enhancer genetic screens to identify functional relationships

    • CRISPR-Cas9 multiplex editing to simultaneously target multiple components of iron homeostasis pathways

  • Subcellular co-localization:

    • Multi-color fluorescence microscopy to track potential co-localization of VIT with other proteins

    • Fractionation studies to isolate protein complexes from specific membrane compartments

    • Super-resolution microscopy to detect nanoscale proximity of different iron transport components

  • Systems biology approaches:

    • Mathematical modeling of iron homeostasis networks incorporating VIT function

    • Metabolomics analysis to identify how VIT activity affects iron-dependent metabolic pathways

    • Integration of transcriptomics, proteomics, and metabolomics data to build comprehensive interaction networks

This integrated approach can reveal how VIT functions within the broader context of iron sensing, transport, and storage mechanisms, potentially identifying novel regulatory connections and feedback loops that maintain iron homeostasis.

What are common challenges in VIT functional studies and how can they be addressed?

Researchers investigating VIT function frequently encounter several technical challenges that can compromise experimental outcomes. Understanding these challenges and implementing appropriate solutions is critical for generating reliable data on VIT activity and function.

ChallengeCauseSolution
Poor recombinant protein expressionMembrane protein nature of VITUse specialized expression systems (P. pastoris, insect cells); optimize codon usage; include solubility-enhancing tags
Protein misfolding and aggregationComplex transmembrane structureExpress at lower temperatures (15-20°C); use gentle detergents; include stabilizing agents in buffer
Inconsistent iron transport assaysMultiple variables affecting transportStandardize liposome composition; control for background iron binding; use multiple technical and biological replicates
Variable phenotypes in transgenic plantsEnvironmental factors affecting iron homeostasisUse controlled growth chambers; include reference genotypes; measure iron parameters across multiple growth stages
Cross-reactivity in immunodetectionSequence similarity between VIT homologsDevelop highly specific antibodies against unique epitopes; validate antibody specificity with knockout controls
Inconsistent tissue iron measurementsContamination during sample preparationImplement metal-free sample preparation protocols; include internal standards; use multiple analytical techniques
Difficulty distinguishing direct vs. indirect effectsComplex iron homeostasis networkCombine acute inducible systems with time-course analyses; use tissue-specific promoters for genetic manipulation
Interference from other metal ionsChemical similarity between iron and other metalsMeasure multiple metal ions simultaneously; include metal chelators as controls; verify specificity using in vitro assays

Additionally, establishing proper controls is essential when working with iron homeostasis genes. For transport assays, use non-functional VIT mutants (with altered key residues like D43 and M80 homologs) as negative controls. For phenotypic studies, include both loss-of-function and gain-of-function lines to distinguish between direct and compensatory effects on iron distribution.

How can researchers effectively compare VIT function across different rice varieties and related cereal crops?

Comparative analysis of VIT function across diverse rice germplasm and related cereal crops provides valuable insights into evolutionary adaptations in iron homeostasis. To effectively conduct such comparative studies, researchers should implement a structured methodological approach:

  • Germplasm selection strategy:

    • Include diverse rice ecotypes (indica, japonica, aus, aromatic) representing different cultivation environments

    • Select varieties with known differences in iron accumulation patterns

    • Include wild rice species as evolutionary reference points

    • Extend to related cereals (wheat, barley, maize) for broader evolutionary context

  • Sequence analysis framework:

    • Perform comprehensive phylogenetic analysis of VIT genes across selected species

    • Identify conserved domains and variable regions that might confer functional specificity

    • Analyze promoter regions for cis-regulatory elements that might drive expression differences

    • Employ computational protein structure prediction to identify potentially significant structural variations

  • Functional characterization approach:

    • Use heterologous expression systems (yeast complementation) to directly compare transport capacity

    • Develop standardized assays for iron distribution patterns across tissues

    • Implement reciprocal genetic complementation studies (e.g., expressing wheat VIT in rice vit mutants)

    • Quantify expression patterns using RNA-seq with standardized tissue sampling and developmental staging

  • Environmental response assessment:

    • Test VIT function under standardized stress conditions (iron deficiency, excess, combined stresses)

    • Analyze iron partitioning in response to developmental triggers like flowering

    • Measure iron remobilization efficiency during grain filling

    • Compare responses to altered growth conditions (hydroponic systems vs. soil cultivation)

  • Data integration framework:

    • Develop standardized phenotyping protocols to allow direct comparison across species

    • Create comprehensive databases incorporating sequence, expression, and functional data

    • Apply machine learning approaches to identify patterns correlating sequence features with functional differences

    • Implement network analysis to compare VIT's position in iron homeostasis networks across species

This comparative approach can reveal evolutionary adaptations in VIT function that might be exploited for crop improvement strategies tailored to specific agricultural environments and nutritional goals.

What novel experimental approaches are emerging for studying VIT transport mechanisms?

Cutting-edge technological advances are revolutionizing our ability to investigate VIT transport mechanisms with unprecedented precision. Several emerging approaches show particular promise for advancing our understanding of these critical transporters:

  • Cryo-electron microscopy (Cryo-EM) for structural determination:

    • Enables visualization of VIT proteins in native-like lipid environments

    • Allows identification of conformational changes during the transport cycle

    • Can reveal substrate binding sites and mechanistic details of iron transport

    • Recent advances in sample preparation and detector technology make this increasingly feasible for membrane transporters like VIT

  • Advanced imaging techniques for in vivo iron tracking:

    • X-ray fluorescence microscopy with synchrotron radiation for high-resolution iron distribution mapping

    • Multi-isotope imaging mass spectrometry (MIMS) to track iron movement in tissues with subcellular resolution

    • Genetically encoded iron sensors that allow real-time visualization of iron dynamics in living cells

    • Super-resolution microscopy combined with metal-specific probes for nanoscale localization

  • Single-molecule approaches for transport kinetics:

    • Single-molecule FRET to observe conformational changes during transport cycles

    • Lipid nanodiscs combined with atomic force microscopy to study individual transporter molecules

    • Single-vesicle transport assays that can detect individual iron transport events

    • Microfluidic platforms for high-throughput analysis of transporter variants

  • CRISPR-based technologies for precise genetic manipulation:

    • Base editing for introducing specific amino acid changes without double-strand breaks

    • Prime editing for precise modification of VIT genes and regulatory elements

    • CRISPR interference/activation (CRISPRi/CRISPRa) for temporally controlled modulation of VIT expression

    • CRISPR-mediated homology-directed repair for introducing reporter tags at endogenous loci

  • Integrative multi-omics approaches:

    • Combined transcriptomics, proteomics, ionomics, and metabolomics to build comprehensive models of iron homeostasis

    • Spatial transcriptomics to map VIT expression patterns with unprecedented resolution

    • Single-cell approaches to uncover cell-type specific roles of VIT transporters

    • Systems biology frameworks incorporating VIT transport kinetics into whole-plant iron distribution models

These emerging technologies promise to overcome longstanding technical barriers in studying membrane transporters, potentially revealing new aspects of VIT function that could be exploited for biofortification strategies or basic understanding of iron homeostasis mechanisms.

What are the most promising research directions for understanding VIT-mediated iron homeostasis in rice?

The field of VIT-mediated iron homeostasis research in rice is poised for significant advances through several promising research directions. The most pressing questions and approaches include:

  • Understanding transport regulation mechanisms: Investigating how post-translational modifications of VIT proteins (phosphorylation, ubiquitination) regulate their activity in response to iron status and developmental signals. This includes identifying the kinases, phosphatases, and other regulatory proteins that directly modify VIT function.

  • Characterizing tissue-specific functions: Developing tissue-specific knockout and knockdown lines to dissect the differential roles of VIT1 and VIT2 in various tissues, particularly focusing on their unique contributions to iron distribution during grain filling versus vegetative growth .

  • Exploring environmental adaptation: Investigating how VIT function is modulated under various environmental stresses (drought, salinity, heat) that affect rice productivity and nutritional quality. This includes understanding how VIT-mediated iron storage contributes to stress tolerance mechanisms.

  • Uncovering signaling networks: Mapping the signaling cascades that connect iron sensing to VIT regulation, particularly focusing on how information about iron status is communicated between different tissues and integrated with other nutrient signaling pathways.

  • Developing targeted biofortification strategies: Creating precision breeding and gene editing approaches that modify VIT function specifically in certain tissues (reducing activity in nodes and leaf sheaths while maintaining it in other tissues) to optimize iron distribution to grains without compromising plant health .

These research directions will collectively advance our understanding of how rice plants balance iron homeostasis across different tissues and developmental stages, ultimately providing the knowledge base needed for sustainable iron biofortification strategies.

How might VIT research contribute to broader understanding of nutrient transport in plants?

Research on VIT transporters has implications that extend far beyond iron homeostasis in rice, potentially informing our understanding of fundamental principles in plant nutrient transport. Several key contributions include:

  • Vacuolar sequestration as a regulatory mechanism: VIT research reveals how compartmentalization into vacuoles serves as a critical regulatory mechanism for controlling nutrient bioavailability. This principle likely applies to other nutrients, suggesting that similar vacuolar transport systems might be central to homeostasis of multiple metals and other nutrients.

  • Coordination of source-sink relationships: Studies of iron distribution patterns in VIT mutants illuminate how plants coordinate nutrient allocation between source and sink tissues . These mechanisms likely represent conserved strategies for resource allocation that apply across multiple nutrient types and plant species.

  • Integration of transport systems: VIT research demonstrates how different transport proteins work in concert to maintain proper nutrient balance. Understanding these integrated transport networks provides a framework for studying other nutrient distribution systems in plants.

  • Evolutionary adaptation of transport mechanisms: Comparative analysis of VIT function across species provides insights into how transport mechanisms adapt to different ecological niches and domestication pressures. This evolutionary perspective enriches our understanding of how plants optimize nutrient acquisition and distribution strategies.

  • Membrane transporter structure-function relationships: Structural studies of VIT proteins contribute to broader knowledge about how membrane transporters achieve selective transport of specific substrates, including the molecular determinants of substrate specificity and transport kinetics.

By elucidating these broader principles, VIT research contributes to a more comprehensive understanding of how plants coordinate nutrient transport networks to maintain homeostasis under fluctuating environmental conditions - knowledge that has implications for improving nutrient use efficiency across multiple crop species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.