Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter homolog 1 (Os02g0644200, LOC_Os02g43030)
Description
Vacuolar Iron Transporters in Plants
In plants, iron homeostasis involves sophisticated mechanisms for uptake, transport, utilization, and storage. Vacuolar iron transporters (VITs) play crucial roles in these processes by mediating the sequestration of iron into vacuoles, which serve as the primary storage compartments for iron in plant cells. This sequestration prevents potentially toxic accumulation of iron in the cytoplasm while maintaining reserves that can be mobilized when needed .
In rice, the VIT family includes multiple members, with OsVIT1 and OsVIT2 being key transporters involved in iron distribution throughout the plant. Understanding these transporters is essential for elucidating the mechanisms controlling iron accumulation in rice grains and developing strategies to enhance iron content in this important staple crop.
Gene Structure and Annotation
OsVIT1 is encoded by the locus Os02g0644200 (also annotated as LOC_Os02g43030) located on chromosome 2 of the rice genome . Genome annotation studies classify this gene as encoding an "integral membrane protein, putative, expressed" , reflecting its predicted function in membrane transport.
Table 1: Gene Annotation Information for OsVIT1
| Characteristic | Information |
|---|---|
| Gene Locus | Os02g0644200 |
| Alternative ID | LOC_Os02g43030 |
| Chromosome | 2 |
| Functional Annotation | Integral membrane protein, putative, expressed |
| Gene Family | Vacuolar iron transporter |
Protein Structure and Function
As a vacuolar iron transporter, OsVIT1 is characterized by multiple transmembrane domains that anchor the protein within the vacuolar membrane and facilitate iron transport. These transporters typically function by moving iron (primarily as Fe²⁺) from the cytoplasm into the vacuolar lumen, contributing to iron homeostasis within plant cells.
The recombinant form of OsVIT1 enables detailed biochemical and structural studies of this important transporter. Similar to other recombinant proteins in this family, such as Vacuolar iron transporter homolog 3 , recombinant OsVIT1 can be used for in vitro studies of transport activity, structure-function relationships, and potential interactions with other components of iron homeostasis machinery.
Tissue-Specific Expression Patterns
While the provided search results contain limited direct information about OsVIT1's specific expression pattern, studies on the related transporter OsVIT2 provide context for understanding where and when OsVIT1 might be expressed. OsVIT2 shows specific expression in the parenchyma cell bridges of nodes, the mestome sheath of leaf sheath, and the aleurone layer of the caryopsis .
Table 2: Comparative Expression Patterns of Vacuolar Iron Transporters in Rice
Expression analysis of OsVIT1 across different tissues and developmental stages would be necessary to determine its specific expression pattern and potential functional specialization compared to OsVIT2. Studies examining expression patterns at different growth stages would provide insights into when OsVIT1 is most active during the rice plant's life cycle .
Subcellular Localization
As a vacuolar iron transporter, OsVIT1 is expected to localize primarily to the tonoplast (vacuolar membrane), where it would mediate iron transport between the cytoplasm and vacuole. This localization is essential for its function in sequestering iron into vacuoles for storage and detoxification. The recombinant form of OsVIT1 can be used in localization studies to confirm its presence in the vacuolar membrane and investigate potential additional localizations.
Role in Iron Distribution to Rice Tissues
Studies on OsVIT2 have revealed critical insights into how vacuolar iron transporters affect iron distribution in rice plants. Mutation of OsVIT2 results in significant changes in iron partitioning among different tissues, as summarized in Table 3.
Table 3: Effects of OsVIT2 Knockout on Iron Distribution in Rice
These findings suggest that OsVIT2 normally functions to sequester iron in vegetative and protective tissues, limiting its availability for transport to grains. When this sequestration is disrupted, more iron becomes available for translocation to the grains, particularly the endosperm, which constitutes the bulk of polished rice.
Recombinant Protein Applications
Recombinant forms of vacuolar iron transporters, including OsVIT1, have valuable applications in research and biotechnology. Similar to other recombinant proteins in this family , recombinant OsVIT1 can facilitate:
-
Biochemical characterization of transport activity and specificity
-
Structure-function studies to understand the mechanisms of iron transport
-
Generation of antibodies for localization and interaction studies
-
In vitro assays of potential inhibitors or activators
-
Protein interaction studies to identify partners in iron transport processes
The availability of recombinant OsVIT1 enables these research applications, contributing to our understanding of iron transport mechanisms in rice and potentially informing strategies for improving iron content in rice grains.
Biofortification Potential
One of the most promising applications of research on vacuolar iron transporters is the development of iron-biofortified rice varieties. Studies on OsVIT2 have demonstrated that knockout of this gene increases iron accumulation in polished rice without yield penalty , suggesting a potential strategy for improving the nutritional quality of rice.
The increased iron accumulation in grains of OsVIT2 knockout plants results from altered iron distribution rather than increased total iron uptake, with iron that would normally be sequestered in vegetative tissues being redirected to developing grains . This represents an efficient approach to biofortification that does not require increased iron uptake from the soil.
Similar approaches targeting OsVIT1 could potentially contribute to biofortification efforts, either alone or in combination with modifications to other transporters such as OsVIT2. Understanding the specific functions and expression patterns of OsVIT1 would be essential for designing effective biofortification strategies involving this transporter.
Table 4: Potential Biotechnological Applications of OsVIT1 Research
| Application | Description | Potential Impact |
|---|---|---|
| Iron biofortification | Modifying OsVIT1 expression or activity to increase iron content in rice grains | Improved nutritional quality of rice, addressing iron deficiency |
| Marker-assisted breeding | Using OsVIT1 genetic variants as markers for selecting rice varieties with improved iron content | Accelerated development of iron-biofortified rice varieties |
| Transgenic approaches | Introducing modified OsVIT1 genes to alter iron distribution in rice | Targeted enhancement of iron content in edible portions of rice |
| Basic research | Using OsVIT1 as a model for studying iron transport mechanisms | Advances in fundamental knowledge of plant nutrition and metal homeostasis |
Functional Relationship
OsVIT1 and OsVIT2 are homologs within the vacuolar iron transporter family in rice, likely arising from gene duplication events during evolution. While both transporters are involved in iron homeostasis, they may have evolved some degree of functional specialization in terms of tissue expression, regulation, or transport kinetics.
Research on OsVIT2 has established its expression in specific tissues, including the parenchyma cell bridges of nodes, the mestome sheath of leaf sheath, and the aleurone layer of the caryopsis . This expression pattern correlates with its function in sequestering iron in these tissues, affecting iron distribution throughout the plant.
Comparative studies between OsVIT1 and OsVIT2 would provide valuable insights into their respective roles in iron homeostasis and potential functional redundancy or specialization. Such studies could involve:
-
Detailed expression analysis of both transporters across tissues and developmental stages
-
Comparative phenotypic analysis of single and double knockout mutants
-
Biochemical characterization of transport activity and specificity
-
Investigation of potential interactions between the two transporters or with other components of iron homeostasis machinery
Role in Iron Biofortification Strategies
The demonstration that OsVIT2 knockout increases grain iron content without yield penalty highlights the potential of vacuolar iron transporters as targets for biofortification strategies. Understanding the specific contributions of OsVIT1 to iron homeostasis would inform whether similar approaches targeting this transporter could enhance iron biofortification efforts.
If OsVIT1 and OsVIT2 have partially redundant functions, manipulating both transporters might have additive or synergistic effects on grain iron content. Alternatively, if they function in different tissues or developmental stages, combined approaches might address multiple bottlenecks in iron translocation to grains.
Future Research Directions
Several key areas for future research on OsVIT1 include:
-
Detailed expression analysis across tissues and developmental stages to determine its specific expression pattern and potential functional specialization
-
Generation and analysis of OsVIT1 knockout or overexpression lines to assess effects on iron distribution and grain iron content
-
Biochemical characterization of transport activity and substrate specificity using recombinant protein
-
Investigation of potential interactions with OsVIT2 and other iron transporters
-
Exploration of natural variation in OsVIT1 across rice varieties and its correlation with grain iron content
-
Development and testing of biofortification strategies targeting OsVIT1 alone or in combination with other transporters
Product Specs
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will prepare accordingly.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance. Additional fees may apply.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Target Background
Q&A
What is the biological function of OsVIT1 in rice plants?
OsVIT1 functions as a vacuolar membrane transporter that plays a crucial role in iron homeostasis and translocation in rice. Research has demonstrated that OsVIT1 primarily mediates the transport of Fe²⁺, Zn²⁺, and Mn²⁺ across the tonoplast into vacuoles, serving as a storage mechanism for excess metal ions . This protein is highly expressed in flag leaf blades, indicating its tissue-specific role in source organs. Importantly, functional disruption of OsVIT1 leads to increased Fe/Zn accumulation in rice seeds with a corresponding decrease in flag leaves, suggesting its central role in regulating metal ion translocation between source and sink organs . This mechanism represents a potential target for biofortification strategies aimed at enhancing Fe/Zn content in rice grains.
What is the molecular structure and sequence characteristics of OsVIT1?
The OsVIT1 protein (Q6H658) consists of 232 amino acids with the following sequence:
MAIDLGCHVGCASPETKQEETADPTAAPVVVDDVEAAAGGRRPGDGGGVNYVARAQWLRA AVLGANDGLVSVASLMVGVGAANGTRRAMLVSGLAGLVAGACSMAIGEFVSVYAQCDIQA AQIERARGGKDADGGEEEEELPSPTMAAVASALSFAAGAALPLLAGGFVRPWAARVAAVC AASSLGLAGFGVASAYLGGAGVARSGVRMLVGGWLAMAVTYGVLKLFGMHGV
The protein features transmembrane domains that facilitate its function in vacuolar membrane transport. As an ortholog of Arabidopsis VIT1, it shares conserved functional domains typically associated with metal ion transport across membranes . Bioinformatic analysis reveals that OsVIT1 contains characteristic motifs associated with cation transport, consistent with its experimentally verified function in transporting multiple divalent metal ions.
What expression systems are optimal for producing recombinant OsVIT1?
-
Bacterial Expression Systems: E. coli-based expression remains the most common method for initial structural studies and antibody production. The His-tagged version allows for efficient purification via nickel affinity chromatography .
-
Plant-Based Expression Systems: For functional studies requiring proper post-translational modifications, rice cell suspension cultures offer advantages. Rice expression systems provide the appropriate glycosylation patterns and protein folding environment that might be critical for maintaining OsVIT1's native conformation and function .
-
Yeast Expression Systems: Studies have demonstrated that ectopic expression of OsVIT1 in yeast mutants (Δccc1 and Δzrc1) can partially rescue Fe²⁺- and Zn²⁺-sensitive phenotypes, making yeast a valuable heterologous system for functional characterization .
The choice of expression system should align with research objectives—bacterial systems for structural studies and plant-based systems for functional analyses requiring native folding and glycosylation.
What purification challenges are associated with recombinant OsVIT1 and how can they be addressed?
Purification of membrane proteins like OsVIT1 presents several technical challenges:
-
Solubilization: As a vacuolar membrane protein, OsVIT1 requires careful solubilization using appropriate detergents. A systematic screening of detergents (CHAPS, DDM, or Triton X-100) at varying concentrations is recommended to maintain protein stability and function.
-
Maintaining Protein Stability: The recombinant protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability . For long-term storage, addition of 5-50% glycerol (with 50% being optimal) followed by aliquoting and storage at -20°C/-80°C is recommended to prevent degradation .
-
Preventing Aggregation: Repeated freeze-thaw cycles should be avoided as they promote protein aggregation . Working aliquots should be maintained at 4°C for up to one week to preserve protein integrity.
-
Reconstitution Protocol: For optimal results, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .
How can functional assays be designed to characterize OsVIT1's metal transport activity?
To characterize the metal transport activity of OsVIT1, researchers can employ the following experimental approaches:
-
Yeast Complementation Assays: Expression of OsVIT1 in metal-sensitive yeast mutants (Δccc1 for Fe sensitivity and Δzrc1 for Zn sensitivity) can demonstrate functional complementation by restoring growth under high metal conditions .
-
Vacuolar Metal Accumulation Assays: Measurement of vacuolar Fe²⁺, Zn²⁺, and Mn²⁺ content in yeast expressing OsVIT1 can quantitatively assess transport activity. Research has shown increased accumulation of these metals in vacuoles of yeast expressing OsVIT1 .
-
Radioisotope Uptake Studies: Using radiolabeled metals (⁵⁵Fe, ⁶⁵Zn) to track transport across membrane vesicles derived from cells expressing OsVIT1 can provide direct evidence of transport kinetics.
-
Electrophysiological Methods: Patch-clamp techniques applied to vacuolar membranes can characterize the biophysical properties of ion transport mediated by OsVIT1.
These complementary approaches provide robust evidence of OsVIT1's metal transport specificity, efficiency, and regulatory mechanisms.
What genetic modification strategies can be employed to study OsVIT1 function in planta?
Several genetic approaches can be used to investigate OsVIT1 function in rice plants:
-
Loss-of-Function Analysis: CRISPR/Cas9-mediated gene editing or T-DNA insertion mutants can generate OsVIT1 knockout lines. Previous studies have shown that functional disruption of OsVIT1 leads to increased Fe/Zn accumulation in rice seeds with a corresponding decrease in flag leaves .
-
Overexpression Studies: Constitutive or tissue-specific overexpression of OsVIT1 under promoters like CaMV 35S or endogenous tissue-specific promoters can help understand the consequences of enhanced vacuolar sequestration of metals.
-
Promoter-Reporter Fusions: Creating transgenic plants with OsVIT1 promoter-GUS/GFP fusions can reveal the spatial and temporal expression patterns and regulatory elements controlling gene expression. Research indicates high expression in flag leaf blades, suggesting tissue-specific regulation .
-
Protein Localization Studies: Transient expression of OsVIT1:EGFP protein fusions has confirmed vacuolar membrane localization . This approach can be extended to study co-localization with other transporters or regulatory factors.
These genetic approaches collectively provide a comprehensive understanding of OsVIT1 function in planta and its contribution to iron homeostasis.
How does OsVIT1 expression respond to different iron status conditions and what regulatory mechanisms are involved?
The expression of OsVIT1 in response to iron status involves complex regulatory mechanisms:
-
Transcriptional Regulation: Unlike OsVIT2, which is highly responsive to Fe treatments, OsVIT1 shows more stable expression under varying Fe conditions . This differential regulation suggests distinct transcriptional control mechanisms between these paralogs.
-
Tissue-Specific Expression Patterns: OsVIT1 is predominantly expressed in flag leaf blades, while OsVIT2 shows high expression in flag leaf sheaths . This tissue specialization indicates the presence of tissue-specific transcription factors and regulatory elements.
-
Regulatory Network Analysis: Recent rice regulome landscape mapping has identified open chromatin regions (OCRs) that could potentially regulate OsVIT1 expression. These OCRs are located either in the proximal upstream regions of the transcription start site or in distal intergenic regions, resembling promoters or enhancers .
-
Footprinting Analysis: Transcription factor footprinting analysis can identify tissue-specific regulatory networks that control OsVIT1 expression. This approach can reveal cultivar-polymorphic or trait-associated OCRs by comparing regulatory landscapes between indica and japonica rice varieties .
Understanding these regulatory mechanisms provides insights into how OsVIT1 expression is modulated during development and in response to environmental factors.
What is the role of OsVIT1 in cross-talk between different metal homeostasis pathways?
The involvement of OsVIT1 in multiple metal transport pathways suggests complex cross-talk mechanisms:
Research into these cross-talk mechanisms provides a systems-level understanding of metal homeostasis in rice and identifies potential targets for biofortification strategies.
How can manipulating OsVIT1 contribute to biofortification strategies for improving nutritional quality of rice?
The strategic manipulation of OsVIT1 offers promising approaches for iron and zinc biofortification in rice:
| Approach | Mechanism | Expected Outcome | Challenges |
|---|---|---|---|
| OsVIT1 knockout/knockdown | Reduces vacuolar sequestration in leaves | Increased Fe/Zn translocation to seeds | Potential fitness costs if metals accumulate to toxic levels |
| Tissue-specific silencing | Reduces OsVIT1 expression only in source tissues | Enhanced metal mobilization to grains without compromising vegetative growth | Requires precise promoter selection |
| Promoter engineering | Modifies expression patterns to enhance remobilization during grain filling | Optimal timing of metal translocation | Complex regulatory interactions |
| Protein engineering | Creates variants with altered transport kinetics | Fine-tuned metal partitioning | Requires detailed structure-function understanding |
What are the current challenges in studying OsVIT1 function and what emerging technologies might address these limitations?
Current research on OsVIT1 faces several challenges that emerging technologies may help overcome:
-
Structural Characterization: The membrane-bound nature of OsVIT1 makes structural determination challenging. Advances in cryo-electron microscopy and computational prediction methods like AlphaFold may facilitate structural elucidation, enabling rational engineering approaches.
-
Transport Kinetics Measurement: Current methods for measuring transport activity often rely on indirect measurements. Development of fluorescent metal sensors with subcellular targeting could enable real-time monitoring of transport activity in living cells.
-
Tissue-Specific Function: Understanding the role of OsVIT1 in different tissues requires methods for tissue-specific manipulation. CRISPR-based technologies with tissue-specific promoters or optogenetic control systems could provide precise spatial and temporal control over gene expression.
-
Interaction Partners: Identifying proteins that interact with OsVIT1 to regulate its function or localization remains challenging. Advanced proximity labeling techniques combined with mass spectrometry could reveal the OsVIT1 interactome.
-
Integration with Global Regulatory Networks: Recent developments in rice regulome mapping provide opportunities to understand how OsVIT1 fits within broader regulatory networks . Integration of chromatin accessibility data with expression profiles can reveal the regulatory mechanisms controlling OsVIT1 expression.
By addressing these challenges with emerging technologies, researchers can gain deeper insights into OsVIT1 function and its potential applications in crop improvement.
What quality control measures should be implemented when working with recombinant OsVIT1?
When working with recombinant OsVIT1, implementing rigorous quality control measures ensures reliable experimental outcomes:
-
Protein Purity Assessment: SDS-PAGE analysis should confirm >90% purity as a minimum standard for functional studies . Multiple purification steps may be necessary to achieve this level of purity.
-
Functional Verification: Complementation assays in appropriate yeast mutants (Δccc1 and Δzrc1) should demonstrate that the purified protein retains transport activity for Fe²⁺ and Zn²⁺ .
-
Protein Folding and Stability: Circular dichroism spectroscopy can assess secondary structure integrity, while thermal shift assays can evaluate protein stability under various buffer conditions.
-
Batch Consistency: Each preparation should be compared to reference standards to ensure consistent activity levels. Variations between batches should be documented and accounted for in experimental design.
-
Storage Validation: Stability studies should verify protein integrity after storage under recommended conditions. Activity assays performed before and after storage can confirm retention of function .
These quality control measures minimize experimental variability and enhance reproducibility in OsVIT1 research.
How should researchers interpret contradictory data regarding OsVIT1 function across different experimental systems?
When faced with contradictory results regarding OsVIT1 function, researchers should consider several factors:
-
Expression System Differences: Results from E. coli, yeast, and plant-based expression systems may differ due to variations in post-translational modifications, membrane composition, and the presence of interacting partners .
-
Genetic Background Effects: Research in different rice varieties (indica vs. japonica) may yield different outcomes due to genetic polymorphisms in regulatory regions or interacting genes .
-
Experimental Conditions: Metal transport activity is influenced by pH, temperature, and ionic strength. Standardization of these parameters is essential for comparing results across studies.
-
Physiological Context: In vitro transport assays may not fully recapitulate the complexity of in vivo systems where multiple transporters function in concert.
-
Technical Limitations: Different detection methods vary in sensitivity and specificity for measuring metal transport. Complementary approaches should be employed to validate key findings.
To resolve contradictions, researchers should carefully document experimental conditions, validate findings using multiple approaches, and consider the biological context when interpreting results.
