Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter homolog 2 (Os04g0538400, LOC_Os04g45520)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

The gene Os04g0538400 belongs to the CCC1 family of vacuolar iron transporters, which are conserved across plants, fungi, and protists but absent in metazoans . Key genomic and functional details include:

AttributeDescription
Chromosome LocationChromosome 4 (NC_008397.2; 27330014–27331189, complement)
Subcellular LocalizationVacuole membrane; multi-pass transmembrane protein
Functional MotifsConserved CCC1 family motifs involved in metal ion transport
Expressed TissuesFlag leaf blades, sheaths (in native rice)
Related PathwaysIron homeostasis, symbiotic nitrogen fixation, petal coloration

Functional Roles in Plant Iron Homeostasis

Os04g0538400 is integral to iron regulation in rice, acting as a vacuolar iron transporter to sequester excess iron and prevent cellular toxicity. Key findings include:

Primary Functions

  • Iron Sequestration: Transport of Fe²⁺ into vacuoles to maintain cytosolic iron balance, critical under iron-rich conditions .

  • Tissue-Specific Regulation: High expression in flag leaves and sheaths, suggesting a role in iron translocation to seeds .

  • Cross-Species Homology: Shares functional similarity with Arabidopsis AtMEB2 and Brassica napus BnMEB2, which enhance iron tolerance in mutants .

Evolutionary Context

The VIT gene family expanded via tandem and segmental duplications, with conserved gene organization and motifs across plant species . Soybean VIT genes exhibit divergent expression patterns under iron stress, highlighting their adaptability in iron-limited environments .

Research Applications and Experimental Insights

Recombinant Os04g0538400 is used in studies to:

  1. Investigate Iron Transport Mechanisms: Yeast complementation assays confirm its ability to rescue iron toxicity in Δccc1 mutants .

  2. Enhance Iron Biofortification: Overexpression in crops like wheat increases iron content in grains, a strategy to address global micronutrient deficiencies .

  3. Study Vacuolar Detoxification: Localization to vacuolar membranes enables sequestration of toxic metals (e.g., Zn²⁺, Mn²⁺) alongside iron .

Key Experimental Data

ExperimentOutcomeSource
Yeast ComplementationRescued growth in Δccc1 mutants under high Fe²⁺ conditions
Iron Content in LeavesMutations reduced iron in flag leaves, indicating transport role
Protein LocalizationConfirmed vacuolar membrane targeting via transient expression assays

Comparative Analysis with Related Transporters

Os04g0538400 differs from other VIT homologs in sequence length and tissue specificity. A comparison with OsVIT1 (Os04g0463400) is illustrative:

AttributeOs04g0538400 (VIT2)OsVIT1 (VIT1)
Length189 aa252 aa
UniProt IDB7F138Q6MWE5
Primary TissueFlag leaves, sheathsSeeds, embryos
FunctionVacuolar iron sequestrationEmbryo iron storage, manganese transport

Research Challenges and Future Directions

While recombinant Os04g0538400 has advanced iron transport studies, gaps remain:

  • Mechanistic Details: Proton-driven Fe²⁺ transport kinetics require further characterization .

  • Interactions: Limited data on protein-protein interactions or post-translational modifications .

  • Agricultural Applications: Optimization of expression systems for crop biofortification .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Os04g0538400; LOC_Os04g45520; OSJNBa0091D06.17; Vacuolar iron transporter homolog 2; Protein NODULIN-LIKE 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os04g0538400
Target Protein Sequence
MARAQWLRAAVLGANDGLVSVASLMIGIGAVNENNKAMLVSGLAGLVAGACSMAIGEFVS VYAQYDIEVTQIERDGDIDGADAAAAREKLPSPTQAAFASALAFAIGGLLPLLTSGFIKP WGPRVGVVCAASSVGLAGFGAAGGYLGGANMVRSGTRVLLGGWLAMLITYAVLRLFATIF HGMNISSSA
Uniprot No.

Target Background

Function

This protein is a probable vacuolar iron transporter potentially involved in regulating iron distribution within the plant.

Database Links
Protein Families
CCC1 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Vacuolar Iron Transporter Homolog 2 in rice?

Vacuolar Iron Transporter Homolog 2 (VIT2) in rice primarily functions as a transporter protein that facilitates the movement of iron ions into vacuoles. Similar to other VIT family members, it plays a crucial role in iron homeostasis by sequestering excess iron in vacuolar compartments, which serves as a buffering mechanism to prevent cellular toxicity when plants are exposed to high iron concentrations . This detoxification function is essential for maintaining optimal physiological iron levels within rice cells. VIT proteins are generally responsible for safe storage of iron and contribute significantly to the plant's ability to survive and adapt to adverse environmental conditions, particularly under iron excess stress .

How is VIT2 gene expression regulated in response to iron stress?

VIT2 gene expression in rice is dynamically regulated in response to iron availability. Based on studies of homologous proteins in other plants, VIT2 is typically upregulated under high iron concentration conditions, particularly in mature tissues . For instance, the BnMEB2 gene in rapeseed (a VIT homolog) showed significantly increased expression when exposed to exogenous iron stress in both roots and leaves . This adaptive response allows the plant to enhance its iron sequestration capacity when facing potentially toxic iron levels. The regulation likely involves complex transcriptional networks and signaling pathways that sense iron status and trigger appropriate gene expression changes to maintain iron homeostasis .

What cellular localization pattern does VIT2 exhibit?

Vacuolar Iron Transporter Homolog 2 in rice is predominantly localized to the vacuolar membrane (tonoplast). This localization pattern has been confirmed in homologous proteins, such as BnMEB2 in rapeseed, through transient expression analysis . The vacuolar membrane localization is consistent with its function in transporting iron ions from the cytosol into the vacuolar lumen. This strategic positioning enables VIT2 to effectively sequester excess iron away from sensitive cellular components, thereby preventing oxidative damage that could result from iron-catalyzed production of reactive oxygen species in the cytosol .

How does VIT2 contribute to iron tolerance in rice?

VIT2 contributes to iron tolerance in rice primarily through vacuolar detoxification, which is a key mechanism for plants to cope with metal toxicity . By transporting excess iron from the cytosol into vacuoles, VIT2 prevents the accumulation of free iron ions that could catalyze the formation of harmful reactive oxygen species through Fenton reactions. Studies of homologous genes have demonstrated that overexpression of VIT genes significantly enhances plant tolerance to high iron concentrations . For example, overexpression of BnMEB2 in Arabidopsis resulted in greatly improved iron tolerability without significant changes in the expression of other VIT genes, suggesting a direct contribution to iron stress management .

What is known about the tissue-specific expression pattern of VIT2?

While specific data for rice VIT2 is limited in the provided search results, insights can be drawn from homologous VIT proteins studied in other plants. VIT family members typically show tissue-specific expression patterns that reflect their roles in iron homeostasis across different plant organs. For instance, BnMEB2 in rapeseed showed high expression in mature (60-day-old) leaves and was significantly induced by exogenous iron stress in both roots and leaves . In rice, VIT homologs like OsVIT1 and OsVIT2 have been reported to modulate iron translocation between flag leaves and seeds, suggesting importance in reproductive tissues . This tissue-specific expression likely reflects the varying iron requirements and storage capacities of different plant organs.

What experimental approaches are most effective for functional characterization of rice VIT2?

For comprehensive functional characterization of rice VIT2, a multi-faceted experimental approach is recommended. First, heterologous expression systems provide valuable functional insights: expressing rice VIT2 in yeast mutants lacking endogenous iron transporters (such as ccc1) allows for complementation assays under high iron conditions . Second, generating transgenic rice lines with VIT2 overexpression or CRISPR/Cas9-mediated knockouts enables phenotypic assessment of growth parameters, iron content measurements, and stress tolerance under various iron regimes.

Third, subcellular localization should be confirmed using fluorescent protein fusions and confocal microscopy to verify vacuolar membrane targeting . Fourth, in vitro transport assays using isolated vacuolar membrane vesicles can directly measure iron transport activity. Additionally, RNA-seq analysis comparing wild-type and VIT2-modified plants under normal and iron stress conditions can reveal broader transcriptomic impacts and downstream pathways affected by VIT2 function . This integrated approach provides comprehensive understanding of VIT2's role in rice iron homeostasis.

How does the amino acid sequence and structure of rice VIT2 compare to other VIT family members?

Rice VIT2 belongs to the conserved Vacuolar Iron Transporter family, which includes members from various plant species. Detailed sequence analysis would reveal that rice VIT2 shares significant homology with other plant VITs, particularly in the transmembrane domains that form the iron transport channel. Based on studies of related transporters, VIT proteins typically contain multiple transmembrane domains with conserved residues critical for metal ion coordination and transport .

Key structural features likely include:

FeatureFunctionConservation across VIT family
N-terminal domainRegulatory regionModerately conserved
Transmembrane domainsForm iron transport channelHighly conserved
Metal-binding motifsCoordination of Fe²⁺ ionsHighly conserved
C-terminal domainProtein-protein interactionsVariable

Rice VIT2 would share functional domains with homologs like AtVIT1 in Arabidopsis and BnMEB2 in rapeseed, which are functional homologs of the yeast iron transporter CCC1 . These structural similarities underpin the conserved function of transporting iron into vacuoles for detoxification and storage purposes across plant species.

What transcriptional and post-translational regulatory mechanisms control VIT2 activity under variable iron conditions?

VIT2 activity in rice is likely regulated at multiple levels to respond appropriately to changing iron conditions. At the transcriptional level, iron-responsive elements in the promoter region would interact with transcription factors that sense iron status. Based on studies in other plants, these may include basic helix-loop-helix (bHLH) transcription factors similar to those involved in the iron deficiency response .

Post-translational modifications also play crucial roles in regulating VIT2 activity:

Regulatory MechanismEffect on VIT2Response Condition
PhosphorylationModulates transport activityRapid response to iron fluctuations
UbiquitinationControls protein turnoverLong-term adaptation
Protein-protein interactionsAlters transport efficiencyIntegration with other stress responses
Membrane lipid compositionAffects protein conformationEnvironmental adaptation

Additionally, iron-sensing mechanisms likely involve interaction with metallochaperones that deliver iron to the transporter or iron-binding regulatory proteins that modulate VIT2 function based on cellular iron status . Understanding these multi-layered regulatory mechanisms would provide deeper insight into how rice coordinates iron homeostasis across varying environmental conditions.

How does VIT2 contribute to iron remobilization during seed development in rice?

VIT2 likely plays a significant role in iron remobilization during rice seed development, although the specific mechanisms must be inferred from studies of homologous proteins. During seed development, strategic iron allocation is critical for proper embryo development and seed viability. VIT homologs in rice, such as OsVIT1 and OsVIT2, have been shown to modulate iron translocation between flag leaves and seeds .

The process involves:

  • Initial sequestration of iron in leaf vacuoles via VIT2 during vegetative growth

  • Regulated remobilization during reproductive development

  • Coordinated transport to developing seeds via phloem transport

  • Differential expression patterns of VIT2 in source versus sink tissues during seed filling

This remobilization process is likely coordinated with the expression of iron exporters like NRAMP family transporters, which can retrieve iron from vacuoles when needed . The balance between sequestration and remobilization affects the final iron content in polished rice seeds, which has significant implications for human nutrition given that rice is a staple food for billions of people .

What are the molecular interactions between VIT2 and other components of iron homeostasis machinery in rice?

Rice VIT2 functions within a complex network of proteins involved in iron uptake, transport, storage, and utilization. Key molecular interactions likely include:

These interactions create a dynamic network that allows rice to maintain optimal iron levels across different tissues and developmental stages while adapting to environmental changes in iron availability .

What are the best experimental designs for studying VIT2 expression in response to varying iron concentrations?

To effectively study VIT2 expression patterns in response to varying iron concentrations, a comprehensive experimental design should incorporate both controlled laboratory and field conditions. For controlled studies, a hydroponic system with precisely defined nutrient solutions provides optimal control over iron availability. The following experimental design is recommended:

  • Treatment conditions:

    • Iron deficiency (0-5 μM Fe-EDTA)

    • Optimal iron (20-50 μM Fe-EDTA)

    • Iron excess (100-500 μM Fe-EDTA)

    • Time-course sampling (6h, 12h, 24h, 3d, 7d) after treatment initiation

  • Multi-level expression analysis:

    • RT-qPCR for quantitative measurement of VIT2 transcript levels

    • Protein immunoblotting with VIT2-specific antibodies to assess protein abundance

    • Transcriptome profiling via RNA-seq to capture global expression changes

    • Promoter-reporter constructs (VIT2promoter:GUS) to visualize tissue-specific expression patterns

  • Tissue-specific sampling:

    • Roots, young leaves, mature leaves, stems, and reproductive organs should be analyzed separately as VIT2 expression likely varies across tissues

This experimental approach would generate comprehensive data on VIT2 expression dynamics across varied iron conditions, providing insights into its regulatory mechanisms and physiological relevance in rice iron homeostasis.

How can protein-protein interactions of VIT2 be effectively investigated?

Investigating protein-protein interactions of rice VIT2 requires specialized approaches that account for its membrane-localized nature. A comprehensive strategy would employ multiple complementary methods:

  • Yeast two-hybrid membrane system (split-ubiquitin system):

    • Specifically designed for membrane proteins

    • Allows screening of potential interacting partners from cDNA libraries

    • Requires validation through secondary methods due to potential false positives

  • Co-immunoprecipitation (Co-IP) with epitope-tagged VIT2:

    • Expression of tagged VIT2 (HA, FLAG, or GFP) in rice

    • Membrane solubilization using appropriate detergents

    • Immunoprecipitation followed by mass spectrometry to identify binding partners

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments fused to VIT2 and candidate interactors

    • Co-expression in rice protoplasts or tobacco leaves

    • Visualization of reconstituted fluorescence at interaction sites

  • Proximity-dependent labeling (BioID or TurboID):

    • Fusion of biotin ligase to VIT2

    • Biotinylation of proximal proteins in vivo

    • Purification and identification of biotinylated proteins

  • Förster Resonance Energy Transfer (FRET):

    • For detailed analysis of specific protein pairs

    • Quantitative measurement of protein proximity in living cells

This multi-faceted approach would provide a comprehensive view of VIT2's interactome, revealing its connections to iron sensing, trafficking, and homeostasis networks in rice cells .

What analytical techniques are most suitable for quantifying iron content in different cellular compartments in rice expressing VIT2?

Accurate quantification of iron distribution across cellular compartments in rice requires sophisticated analytical techniques that combine subcellular fractionation with sensitive detection methods. The following analytical approach is recommended:

  • Subcellular fractionation techniques:

    • Differential centrifugation to isolate major organelles

    • Free-flow electrophoresis for purification of vacuoles

    • Density gradient centrifugation for enhanced separation

    • Immunomagnetic isolation using organelle-specific antibodies

  • Iron content measurement methods:

    • Inductively Coupled Plasma Mass Spectrometry (ICP-MS) for high sensitivity quantification

    • Synchrotron X-ray fluorescence (SXRF) microscopy for in situ elemental mapping

    • Perls'/DAB staining for histochemical visualization of iron distribution

    • Phen Green SK fluorescent probe for assessment of labile iron pools

  • Comparative analysis workflow:

Cellular CompartmentIsolation MethodDetection TechniqueExpected Impact of VIT2
VacuoleOsmotic shock/density gradientICP-MS/SXRFIncreased Fe content in VIT2 overexpressors
ChloroplastPercoll gradientICP-MSMinimal direct impact
MitochondriaDifferential centrifugationICP-MSIndirect effects possible
CytosolUltracentrifugation of cell lysateFluorescent probesDecreased labile Fe in VIT2 overexpressors
  • Validation using transgenic approaches:

    • Comparing wildtype, VIT2 overexpression, and VIT2 knockout lines

    • Combining with organelle-targeted iron sensors for real-time monitoring

This comprehensive analytical approach would provide detailed insights into VIT2's role in modulating iron distribution across cellular compartments in rice.

What gene editing strategies would be most effective for functional characterization of VIT2 in rice?

For robust functional characterization of VIT2 in rice, multiple gene editing approaches should be employed to generate a spectrum of modifications that reveal different aspects of VIT2 function:

  • CRISPR/Cas9 knockout strategies:

    • Complete gene knockout using dual gRNAs targeting essential exons

    • Domain-specific modifications to disrupt metal binding or transport function while maintaining protein expression

    • Promoter editing to alter expression patterns without changing protein structure

  • Base editing approaches:

    • Precision modification of specific amino acids in metal-binding regions

    • Introduction of conditional mutations that affect protein function under specific conditions

    • Creation of analog-sensitive variants for chemical genetic studies

  • Prime editing for complex modifications:

    • Introduction of epitope tags for protein tracking and purification

    • Creation of fluorescent protein fusions at endogenous locus

    • Swapping regulatory elements to alter expression patterns

  • Multiplexed editing:

    • Simultaneous targeting of VIT2 and related transporters to address functional redundancy

    • Combined modification of VIT2 and interacting partners to study pathway interactions

  • Experimental design considerations:

    • Generation of homozygous, biallelic modifications

    • Analysis across multiple independent lines to control for off-target effects

    • Comparison with wild-type and complementation lines to confirm phenotype specificity

These strategies should be implemented in relevant rice varieties, particularly those studied in RNA-seq analyses of iron stress responses, to ensure physiological relevance of findings .

How can transcriptomic and metabolomic approaches be integrated to understand the broader impact of VIT2 function?

Integrating transcriptomic and metabolomic approaches provides a powerful systems biology framework for understanding VIT2's role in rice iron homeostasis and broader metabolic networks. An effective integration strategy would include:

  • Experimental design for multi-omics:

    • Parallel sampling for RNA-seq and metabolite extraction

    • Inclusion of VIT2 wildtype, overexpression, and knockout lines

    • Time-course sampling under normal and iron stress conditions

    • Tissue-specific analysis focusing on roots, leaves, and developing seeds

  • Transcriptomic analysis focusing on:

    • Differential expression patterns of iron homeostasis genes

    • Identification of co-expressed gene networks

    • Transcription factor binding site analysis for co-regulated genes

    • Alternative splicing events triggered by iron status changes

  • Metabolomic profiling targeting:

    • Iron-containing metabolites and cofactors

    • Anti-oxidative compounds that respond to iron-induced oxidative stress

    • Primary metabolites affected by altered iron distribution

    • Specialized metabolites involved in iron mobilization (e.g., phytosiderophores)

  • Integrative data analysis:

    • Correlation network analysis linking transcript and metabolite changes

    • Pathway enrichment analysis to identify system-level perturbations

    • Predictive modeling of metabolic fluxes based on gene expression changes

    • Machine learning approaches to identify key regulatory nodes

  • Validation experiments:

    • Targeted metabolite analysis of predicted pathway alterations

    • Expression analysis of key genes in additional genotypes

    • Flux analysis using isotope labeling to confirm predicted metabolic changes

This integrated approach would reveal how VIT2-mediated changes in iron compartmentalization cascade through transcriptional networks to impact broader metabolic functions in rice .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.