Recombinant Oryzias latipes Blue-sensitive opsin

Shipped with Ice Packs
In Stock

Description

Spectroscopic and Photochemical Properties

The opsin exhibits bistable photochemical behavior, enabling reversible transitions between light-absorbing states :

  • Dark State: Binds 11-cis-retinal, absorbing blue light (λₘₐₓ ~460 nm) .

  • Active State: Forms all-trans-retinal upon blue light exposure, triggering G-protein signaling .

  • Photo-reversibility: The all-trans state can convert back to 11-cis, 9-cis, or 7-cis retinal states under orange light (>540 nm), enabling spectral tuning .

Biochemical Function and Signal Transduction

Recombinant Blue-sensitive opsin activates Gi/Go proteins with efficiencies comparable to bovine rhodopsin :

  • Activation Mechanism: Light-induced conformational changes expose G-protein binding sites on intracellular loops .

  • Tissue Distribution: Expressed in retinal ganglion cells, brain nuclei, and peripheral tissues, suggesting roles in circadian entrainment and light-dependent behavior .

Comparative Analysis with TMT2 Opsin

While both TMT1 (Blue-sensitive) and TMT2 opsins are Gi/Go-coupled, their photochemical behaviors differ significantly :

FeatureTMT1 (Blue-Sensitive)TMT2
Active State λₘₐₓVisible light (~460 nm) UV light (~360 nm)
Photo-convertibilityReversible (bistable) Irreversible (monostable)
Retinal IsomerizationForms 7-cis and 9-cis isomers Exclusively all-trans
Tissue LocalizationRetina, brain, peripheral tissues Predominantly eyes and brain

Research Applications and Implications

  • Circadian Biology: Used to study light input pathways in peripheral clocks .

  • Photoreceptor Evolution: Provides insights into the diversification of vertebrate opsins .

  • Drug Discovery: Serves as a model for designing optogenetic tools targeting Gi/Go pathways .

Current Limitations and Future Directions

  • Expression Challenges: Low yield in full-length forms necessitates C-terminal truncation for purification .

  • Structural Data: High-resolution crystal structures are needed to elucidate activation mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Blue-sensitive opsin; Blue cone photoreceptor pigment; KFH-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Oryzias latipes (Japanese rice fish) (Japanese killifish)
Target Protein Sequence
MRGNRLVEFPDDFWIPIPLDTNNVTALSPFLVPQDHLGSPTIFYSMSALMFVLFVAGTAI NLLTIACTLQYKKLRSHLNYILVNMAVANLIVASTGSSTCFVCFAFKYMVLGPLGCKIEG FTAALGGMVSLWSLAVIAFERWLVICKPLGNFVFKSEHALLCCALTWVCGLCASVPPLVG WSRYIPEGMQCSCGPDWYTTGNKFNNESFVMFLFCFCFAVPFSIIVFCYSQLLFTLKMAA KAQADSASTQKAEKEVTRMVVVMVVAFLVCYVPYASFALWVINNRGQTFDLRLATIPSCV SKASTVYNPVIYVLLNKQFRLCMKKMLGMSADEDEESSTSQSTTEVSKVGPS
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules essential for vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Database Links

KEGG: ola:100049179

UniGene: Ola.160

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
The color pigments are found in the cone photoreceptor cells.

Q&A

What is the molecular structure and functional significance of Oryzias latipes Blue-sensitive opsin?

Oryzias latipes Blue-sensitive opsin (UniProt: P87365) is a G protein-coupled receptor that functions as a photoreceptor protein in blue cone cells of the medaka fish retina. The full-length protein consists of 352 amino acids with the sequence beginning with MRGNRLVEFPDDFWIP and contains several transmembrane domains typical of opsin proteins . This protein, also known as Blue cone photoreceptor pigment KFH-B, belongs to the broader family of vertebrate visual pigments. Blue-sensitive opsins play critical roles in color discrimination and are part of the sophisticated visual system that allows aquatic vertebrates to navigate their light-variable environments. The protein's structure enables it to bind the chromophore 11-cis-retinal, forming a photopigment complex that can absorb light in the blue wavelength range, triggering the visual transduction cascade .

How does Blue-sensitive opsin compare with other opsin subtypes in vertebrate vision systems?

Blue-sensitive opsins belong to the SWS1 (short wavelength sensitive) family of visual pigments, which evolved through gene duplication and subsequent differentiation. Unlike rhodopsins (RH1) found in rod cells that function in dim light conditions, blue-sensitive opsins contribute to photopic (bright light) color vision in most vertebrates. In the medaka fish visual system, blue-sensitive opsins work alongside other cone opsins including red-sensitive (LWS) and green-sensitive (RH2) pigments to enable trichromatic color vision .

Unlike some anuran amphibians that have adapted blue-sensitive cone pigments with rhodopsin-like properties for scotopic vision in specialized "green rod" cells, the medaka fish blue-sensitive opsin maintains typical cone pigment characteristics . The spectral tuning of blue-sensitive opsins is achieved through specific amino acid compositions in the retinal binding pocket that influence chromophore conformation. This stands in contrast to TMT opsins (another opsin class found in medaka), which function as blue light-sensitive Gi/Go-coupled receptors but exhibit different photochemical properties and tissue distribution patterns .

What specific genetic and evolutionary patterns characterize Blue-sensitive opsins in teleost fish?

The evolution of blue-sensitive opsins in teleost fish demonstrates fascinating patterns of gene duplication and spectral tuning. In many teleost lineages including medaka, opsin genes have undergone tandem duplications followed by neofunctionalization, providing the genetic basis for spectral diversity. This process has enabled fish to adapt visual systems to various ecological niches and light environments .

Unlike some opsin families where key "spectral tuning sites" have been well-established (such as the "five sites rule" in mammalian LWS opsins), the precise residues controlling spectral sensitivity in blue-sensitive opsins remain less thoroughly characterized. The evolutionary pattern suggests strong selection pressure maintaining functional differentiation between duplicated genes, with substitutions at specific positions (such as position 122 in RH2 opsins, which can cause significant spectral shifts) playing important roles in spectral differentiation .

What molecular dynamics simulation approaches can accurately predict spectral tuning in Oryzias latipes Blue-sensitive opsin?

Molecular dynamics (MD) simulations provide powerful approaches for predicting spectral tuning in blue-sensitive opsins without requiring laborious site-by-site protein modifications. Based on methodologies validated in RH2 opsins, researchers can employ the following protocol for Blue-sensitive opsin analysis:

  • Generate homology models using known opsin crystal structures as templates

  • Conduct all-atom molecular dynamics simulations (typically 100ns or longer) with the chromophore bound

  • Analyze specific conformational parameters of the chromophore, particularly:

    • Torsion angle measurements (especially C7-C6-C5-C18, referred to as Torsion 15)

    • Root mean square fluctuations (RMSF) of all heavy atoms in the chromophore and attached lysine residue

The predictive model developed for RH2 opsins follows the formula:
λmax(predicted) = 475.628 + (-8.720×Torsion 15) + (34.925×RMSF)

This approach can be adapted for blue-sensitive opsins, though validation with experimentally determined λmax values would be necessary. The method reveals how chromophore conformation and dynamics within the binding pocket directly influence spectral sensitivity, with more rigid conformations (lower RMSF values) typically associated with blue-shifted absorption maxima .

What expression systems and purification protocols yield optimal results for functional studies of recombinant Oryzias latipes Blue-sensitive opsin?

Expression and purification of functional recombinant Blue-sensitive opsin presents significant challenges due to membrane protein characteristics. Based on successful approaches with related opsins, researchers should consider:

Expression Systems:

  • Mammalian cell lines (HEK293, COS-7) provide appropriate post-translational modifications and membrane insertion

  • For TMT opsins from medaka, cultured cell expression has proven successful when optimized

  • Insect cell/baculovirus systems may offer higher yields while maintaining proper folding

Purification Protocol:

  • Harvest cells 48-72 hours post-transfection

  • Solubilize membranes using mild detergents (DDM, CHAPS) in Tris-based buffers

  • Purify using affinity chromatography based on added epitope tags

  • Store in 50% glycerol at -20°C to -80°C for extended storage

Critical Considerations:

  • Avoid repeated freeze-thaw cycles as they compromise protein stability

  • Short-term storage (up to one week) can be maintained at 4°C

  • Reconstitution with 11-cis-retinal is essential for functional studies

  • Detergent selection is crucial for maintaining native-like structure

These methodological considerations directly impact experimental outcomes when studying photochemical properties, spectral tuning, and G-protein coupling efficiency.

How do specific amino acid residues in the binding pocket influence spectral tuning and photochemical properties of Blue-sensitive opsin?

The spectral tuning and photochemical properties of Blue-sensitive opsin are primarily determined by amino acid residues that form the chromophore binding pocket and interact with the 11-cis-retinal. Key considerations include:

Critical Tuning Sites:

  • While the "five sites rule" established for mammalian LWS opsins does not extend to SWS1 opsins, several key positions have been identified through comparative studies

  • Residues in transmembrane helices III, VI, and VII contribute significantly to spectral tuning

  • The positioning of counterion residues that stabilize the protonated Schiff base is crucial

Conformational Influence:

  • The conformation of the chromophore, particularly torsion angles along the polyene chain, directly influences λmax

  • Blue-sensitive opsins typically exhibit more restricted chromophore conformations (lower RMSF values) compared to green-sensitive pigments

  • Residues that constrain chromophore movement contribute to blue-shifted absorption spectra

Experimental Approaches:

  • Site-directed mutagenesis coupled with spectroscopic characterization remains the gold standard for identifying key tuning residues

  • Molecular dynamics simulations provide predictions about chromophore behavior without requiring extensive mutagenesis

  • Quantum mechanical/molecular mechanical (QM/MM) methods can provide deeper insight into the electronic states involved in spectral tuning

Understanding these structure-function relationships provides crucial insights for both evolutionary studies and potential optogenetic applications of blue-sensitive opsins.

What methods can resolve contradictions between in vitro and in vivo spectral sensitivity measurements of Blue-sensitive opsin?

Discrepancies between in vitro and in vivo spectral sensitivity measurements of Blue-sensitive opsin present significant challenges for researchers. Several methodological approaches can help resolve these contradictions:

Sources of Discrepancy:

  • Lack of native cellular environment in recombinant systems

  • Different chromophore composition (A1 vs. A2 retinal)

  • Variations in pH and ionic strength between experimental conditions

  • Post-translational modifications present in vivo but absent in vitro

Resolution Strategies:

  • Reconstitution in Nanodiscs or Liposomes:

    • Embedding purified opsin in lipid bilayers more closely mimics native environment

    • Allows control of lipid composition to match cell membrane characteristics

  • Parallel Measurement Techniques:

    • Combine microspectrophotometry of isolated photoreceptors with absorbance spectra of purified pigments

    • Correlate electrophysiological recordings with biochemical measurements

  • Chromophore Standardization:

    • Ensure consistent chromophore identity and isomeric state

    • Account for potential chromophore exchange in vivo

  • Computational Correction Models:

    • Develop correction factors based on systematic comparisons of in vitro and in vivo measurements

    • Apply molecular dynamics-based predictions to bridge experimental approaches

These approaches help create more complete and accurate models of Blue-sensitive opsin function in the context of the medaka visual system.

How does temperature affect thermal stability and spectral properties of Oryzias latipes Blue-sensitive opsin compared to other visual pigments?

Temperature significantly impacts both thermal stability and spectral properties of visual pigments, with important implications for experimental design and interpretation:

Thermal Stability Considerations:

  • Cone opsins generally show higher rates of thermal isomerization than rod opsins

  • This property is critical for understanding signal-to-noise ratios in photoreceptors

  • Interestingly, some anuran blue-sensitive cone pigments have evolved rhodopsin-like thermal stability through specific mutations (such as at position 47)

Temperature Effects on Spectral Properties:

  • Increased temperature typically causes:

    • Small red-shifts in absorption maxima (1-2 nm per 10°C)

    • Broadening of absorption curves

    • Increased rates of dark noise through thermal isomerization

Experimental Approaches:

  • Temperature-Controlled Spectroscopy:

    • Measure absorption spectra across physiologically relevant temperature ranges

    • Determine activation energies for thermal isomerization

  • Dark Noise Measurements:

    • Electrophysiological recordings of isolated photoreceptors at different temperatures

    • Noise analysis to differentiate thermal events from other cellular noise

  • Molecular Dynamics at Various Temperatures:

    • Simulate chromophore behavior at different temperatures

    • Calculate energy barriers for conformational changes

Understanding temperature dependence is particularly relevant for ectothermic species like medaka, whose visual system must function across varying environmental temperatures, unlike the more stable temperature environment of mammalian visual systems.

What is the optimal protocol for regenerating Oryzias latipes Blue-sensitive opsin with various retinal analogs for spectroscopic studies?

Regenerating Blue-sensitive opsin with different retinal analogs allows investigation of structure-function relationships and spectral tuning mechanisms. The following protocol optimizes this process:

Regeneration Protocol:

  • Express and purify the apoprotein in the absence of chromophore or bleach existing chromophore

  • Prepare retinal analog solutions in ethanol (typically 1-10 mM)

  • Add retinal analog to opsin preparation at 1.1-1.5× molar excess

  • Incubate in darkness at 4°C for 12-16 hours

  • Remove excess unbound retinal through gentle washing or mild detergent treatment

  • Confirm regeneration through absorption spectroscopy

Key Retinal Analogs for Comparative Studies:

  • 11-cis-retinal (native chromophore)

  • 9-cis-retinal (studies show TMT1 opsin can photo-convert to this state)

  • 7-cis-retinal (studies show TMT1 opsin can photo-convert to this state)

  • All-trans-retinal (forms during photoactivation)

Analytical Considerations:

  • Monitor regeneration kinetics through time-resolved spectroscopy

  • Determine regeneration efficiency through calculating extinction coefficients

  • Compare stability of different retinal-opsin complexes through thermal denaturation curves

This methodology enables detailed investigation of how chromophore structure influences the spectral and photochemical properties of Blue-sensitive opsin.

What computational approaches can predict G-protein coupling specificity and efficiency for Oryzias latipes Blue-sensitive opsin?

Understanding G-protein coupling is crucial for characterizing signal transduction pathways initiated by Blue-sensitive opsin activation. Several computational approaches can predict coupling specificity and efficiency:

Computational Methods:

  • Sequence-Based Prediction:

    • Analysis of intracellular loops (particularly IC3) and C-terminal sequences

    • Identification of conserved motifs associated with specific G-protein coupling

    • Comparison with known coupling patterns in related opsins (TMT opsins couple to Gi/Go)

  • Structural Modeling:

    • Generate homology models of Blue-sensitive opsin in active conformation

    • Dock G-protein structures to identify interaction interfaces

    • Energy minimization to optimize interaction surfaces

  • Molecular Dynamics of Protein-Protein Interactions:

    • Simulate opsin-G protein complex stability

    • Calculate binding energies for different G-protein subtypes

    • Identify key residues through free energy perturbation analysis

Experimental Validation:

  • GTPγS binding assays with purified G-proteins

  • BRET/FRET assays in cell-based systems

  • Electrophysiological recordings of downstream signaling

By combining these computational predictions with experimental validation, researchers can develop detailed models of Blue-sensitive opsin signaling specificity.

How do the photochemical properties of Oryzias latipes Blue-sensitive opsin compare with homologous proteins in other teleost species?

Comparative analysis of Blue-sensitive opsins across teleost species reveals important insights about evolutionary adaptations and mechanisms of spectral tuning:

Cross-Species Comparisons:

Speciesλmax (nm)Key Tuning ResiduesPhotoproduct FormationRecovery Kinetics
Oryzias latipes~440Not fully characterizedStandard cone opsin photocycleRapid
Zebrafish (Danio rerio)415-417Several identifiedSimilar to other SWS1 opsinsRapid
Goldfish (Carassius auratus)447-455Positions analogous to Rh2 sitesStandard cone opsin photocycleRapid
Cichlids (various species)360-425Highly variable, under selectionVaries with λmaxSpecies-dependent

Key Photochemical Differences:

  • Variation in photobleaching pathways

  • Different intermediate state stabilities

  • Species-specific rates of chromophore release

  • Varying degrees of bistability (ability to regenerate directly with light)

The diversity in photochemical properties corresponds to habitat-specific light environments, with deeper-dwelling species often showing blue-shifted sensitivities compared to surface dwellers . These comparative studies provide crucial context for understanding the specific adaptations in Oryzias latipes Blue-sensitive opsin.

How does the thermal stability of Oryzias latipes Blue-sensitive opsin differ from mammalian blue cone opsins?

Thermal stability represents a critical functional parameter that differs significantly between fish and mammalian blue cone opsins:

Comparative Thermal Properties:

  • Fish visual pigments generally exhibit different thermal stability profiles compared to mammalian counterparts due to adaptation to ectothermic physiology

  • Mammalian blue cone opsins (typically true UV-sensitive SWS1 pigments) generally show higher rates of thermal activation than other cone types

  • The presence of specific stabilizing residues can significantly impact thermal isomerization rates, as demonstrated in anuran blue pigments that acquired rhodopsin-like thermal stability through the T47 mutation

Functional Implications:

  • Higher thermal stability correlates with improved signal-to-noise ratio in photoreception

  • Lower thermal isomerization rates enable detection of dimmer light stimuli

  • Temperature-dependent shifts in absorption spectra may enable temperature sensing in some species

Understanding these differences provides insights into the evolutionary adaptations of visual systems across vertebrate lineages and informs experimental design when studying recombinant opsins under different temperature conditions.

What are the best practices for analyzing structural dynamics of Oryzias latipes Blue-sensitive opsin using hydrogen-deuterium exchange mass spectrometry?

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers powerful insights into protein dynamics and solvent accessibility for membrane proteins like Blue-sensitive opsin:

Optimized HDX-MS Protocol:

  • Sample Preparation:

    • Purify recombinant protein in detergent micelles or nanodiscs

    • Ensure homogeneity through SEC or analytical ultracentrifugation

    • Maintain dark conditions or controlled lighting to prevent unintended photoactivation

  • Exchange Conditions:

    • Conduct deuterium labeling at physiological pH (7.4) and temperature

    • Use time-course measurements (seconds to hours) to capture dynamics at different timescales

    • Quench with low pH and temperature to minimize back-exchange

  • Digestion and Analysis:

    • Optimize pepsin digestion conditions for maximum sequence coverage

    • Consider alternative proteases for improved coverage of transmembrane regions

    • Employ ultra-high-pressure liquid chromatography for rapid separation

  • Data Interpretation:

    • Compare dark state vs. light-activated state exchange patterns

    • Identify regions with altered dynamics upon photoactivation

    • Correlate exchange rates with structural features and functional domains

This methodology provides crucial information about conformational changes during the activation cycle and helps identify regions involved in spectral tuning and G-protein coupling.

What considerations are important when designing FRET-based sensors using Oryzias latipes Blue-sensitive opsin as the photosensitive domain?

FRET-based sensors utilizing Blue-sensitive opsin offer potential for monitoring cellular activities with blue light sensitivity. Key considerations for optimal design include:

Sensor Design Parameters:

  • Fusion Architecture:

    • Identify optimal insertion points that maintain opsin function

    • Consider both N- and C-terminal fusions as well as internal insertions

    • Test multiple linker lengths and compositions to optimize energy transfer

  • FRET Pair Selection:

    • Choose donor/acceptor pairs with spectral overlap appropriate for blue opsin activation

    • Consider mCerulean3/cpVenus or similar pairs with high quantum yields

    • Evaluate potential spectral interference with opsin's intrinsic absorption

  • Response Kinetics:

    • Characterize activation/deactivation rates under different illumination conditions

    • Optimize for either rapid responses or sustained signals based on application

  • Signal-to-Noise Optimization:

    • Minimize basal activity through rational mutagenesis

    • Incorporate stabilizing mutations to reduce dark activity

    • Consider tandem arrangements for signal amplification

Validation Approaches:

  • In vitro spectroscopic characterization

  • Cell-based assays measuring downstream signaling

  • Comparative testing against established optogenetic tools

By carefully addressing these design considerations, researchers can develop novel optogenetic tools with spectral properties complementary to existing systems, expanding the toolbox for light-controlled cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.