Recombinant Oryzias latipes Putative violet-sensitive opsin

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us and we will prioritize the development of the specified tag.
Synonyms
Putative violet-sensitive opsin; KFH-V; Violet cone photoreceptor pigment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Oryzias latipes (Japanese rice fish) (Japanese killifish)
Target Protein Sequence
MGKYFYLYENISKVGPYDGPQYYLAPTWAFYLQAAFMGFVFFVGTPLNFVVLLATAKYKK LRVPLNYILVNITFAGFIFVTFSVSQVFLASVRGYYFFGQTLCALEAAVGAVAGLVTSWS LAVLSFERYLVICKPFGAFKFGSNHALAAVIFTWFMGVVRCPPFFGWSRYIPEGLGCSCG PDWYTNCEEFSCASYSKFLLVTCFICPITIIIFSYSQLLGALRAVAAQQAESASTQKAEK EVSRMIIVMVASFVTCYGPYALTAQYYAYSQDENKDYRLVTIPAFFSKSSCVYNPLIYAF MNKQFNGCIMEMVFGKKMEEASEVSSKTEVSTDS
Uniprot No.

Target Background

Function
Visual pigments are light-absorbing molecules responsible for mediating vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
The three color pigments are found in the cone photoreceptor cells.

Q&A

What is the genomic organization of violet-sensitive opsin (SWS1) in Oryzias latipes?

The violet-sensitive opsin (SWS1) in Oryzias latipes is located on an unplaced scaffold designated as chromosome Un . The gene encodes a protein within the short-wavelength sensitive opsin family. Based on related fish studies, the genomic structure includes multiple exons and introns typical of vertebrate opsin genes, with the coding sequence spanning approximately 1-1.8 kb as determined by restriction fragment analysis . This gene represents one of several opsins in the comprehensive visual system of medaka fish.

What distinguishes violet-sensitive opsin from UV-sensitive opsins at the molecular level?

Violet-sensitive opsin in Oryzias latipes represents an evolutionary adaptation from UV vision to violet vision in teleost fish. This transformation involved specific amino acid substitutions in key positions that interact with the retinal chromophore. The spectral tuning shifts the absorption maximum from the ultraviolet range (360-380 nm) typically seen in UV-sensitive opsins to the violet visible range (400-420 nm). Evidence for this evolutionary replacement comes from genomic analysis showing that in some fish species, ancestral UV opsin genes were completely replaced by violet opsin genes during evolution .

How does the violet-sensitive opsin function within the broader visual system of Oryzias latipes?

In Oryzias latipes, violet-sensitive opsin (SWS1) works alongside other visual opsins including SWS2 (blue-sensitive), RH2 (green-sensitive), and LWS (red-sensitive) to provide color vision across a broad spectrum . Interestingly, research with medaka lacking both SWS1 and SWS2 opsins demonstrates that these fish maintain normal or even enhanced behavioral photosensitivity under UV or blue light . This suggests that green (RH2) and red (LWS) opsins predominantly contribute to luminance detection and optomotor responses, while SWS1 may have more specialized roles in color discrimination or specific ecological tasks .

What expression systems yield functional recombinant Oryzias latipes violet-sensitive opsin?

Two main expression systems have proven effective for producing functional recombinant fish opsins:

  • Mammalian Cell Expression (HEK293T): This system has been successfully employed for medaka fish opsins with the following protocol:

    • Clone opsin cDNA into mammalian expression vector (e.g., pMT4)

    • Add C-terminal epitope tag (e.g., 1D4 tag: ETSQVAPA) for purification

    • Transfect HEK293T cells using calcium phosphate method

    • Incubate 24 hours, then add 11-cis-retinal (5 μM final concentration)

    • Further incubate 24 hours in darkness before harvesting

  • Bacterial Expression (E. coli): Successful expression of His-tagged full-length Oryzias latipes violet-sensitive opsin has been reported, yielding full-length protein (1-334 amino acids) .

The mammalian expression system typically yields properly folded protein with native-like post-translational modifications, making it preferable for functional studies despite lower yields compared to bacterial systems.

What strategies can improve recombinant violet-sensitive opsin yields?

Several approaches have been documented to enhance expression and purification yields:

StrategyImplementationEffectReference
C-terminal truncationRemove 60-65 amino acids from C-terminus~10-fold increase in yield for some opsins
Epitope taggingAdd 1D4 tag (ETSQVAPA) at C-terminusEnables efficient immunoaffinity purification
Optimized detergent extractionUse 1% dodecyl maltoside (DM) in PM buffer*Improved solubilization while maintaining function
Temperature optimizationExpression at 37°C, spectroscopic analysis at 0°CBalances expression with photointermediate stability

*PM buffer: 50 mM HEPES (pH 6.5), 140 mM NaCl, and 3 mM MgCl2

It's important to note that optimization strategies are often opsin-specific. For example, while C-terminal truncation dramatically improved yields for TMT1A opsin, a similar approach did not enhance TMT2 opsin yields .

What are the critical factors for maintaining functionality of purified recombinant opsin?

Maintaining functional integrity requires careful attention to several experimental parameters:

  • Chromophore reconstitution: Addition of 11-cis-retinal at 5 μM final concentration is essential for forming the functional visual pigment .

  • Light protection: All procedures following chromophore addition should be conducted under dim red light or in darkness to prevent premature photoactivation.

  • Buffer composition: The PM buffer (50 mM HEPES at pH 6.5, 140 mM NaCl, and 3 mM MgCl2) preserves stability during purification .

  • Detergent selection: 1% dodecyl maltoside (DM) effectively solubilizes membrane proteins while maintaining their native-like structure .

  • Temperature control: Maintaining 0°C during spectroscopic analysis helps stabilize photointermediates and allows characterization of the photochemical reaction cycle .

What spectroscopic methods best characterize the absorption properties of violet-sensitive opsin?

UV-visible absorption spectroscopy is the primary method for characterizing violet-sensitive opsin's spectral properties. The experimental approach should include:

  • Measurement of dark-state absorption spectrum using purified reconstituted opsin in appropriate buffer/detergent conditions.

  • Sequential irradiation with monochromatic light matching the absorption maximum to track photointermediate formation.

  • Calculation of difference spectra by subtracting the dark-state spectrum from spectra recorded after irradiation to visualize spectral shifts.

While specific spectral data for Oryzias latipes violet-sensitive opsin is not provided in the search results, related medaka opsins show distinct spectroscopic properties. For example, TMT1 opsin exhibits an absorption maximum at 460 nm, while TMT2 opsin shows an absorption maximum around 470 nm with photoactivation shifting its spectrum to the UV region .

How does photoactivation affect violet-sensitive opsin structure and function?

Photoactivation initiates a series of conformational changes that alter both spectral properties and protein-protein interactions:

  • Spectral shifts: Upon absorption of light matching its absorption maximum, violet-sensitive opsin likely undergoes a series of conformational changes that shift its absorption spectrum. In related opsins, these shifts can be toward either longer wavelengths (red-shift) or shorter wavelengths (blue-shift) .

  • Photointermediate formation: The photoactivation process involves formation of spectrally distinct intermediates. For example, in TMT1 opsin, blue light irradiation causes a slight red shift and absorbance increase, while TMT2 opsin shifts to the UV region upon activation .

  • G-protein interaction: The active conformation exposes binding sites that enable interaction with specific G-protein subtypes, initiating downstream signaling cascades. Different opsin types exhibit varying G-protein activation efficiencies .

  • Thermal stability: The active state exhibits different thermal stability compared to the dark state, with some photointermediates being relatively stable at low temperatures (0°C) but rapidly decaying at physiological temperatures .

What molecular determinants control spectral tuning in violet-sensitive versus UV-sensitive opsins?

The spectral tuning that differentiates violet-sensitive from UV-sensitive opsins involves specific amino acid positions that interact with the chromophore:

  • Key tuning sites: Several amino acid positions surrounding the retinal binding pocket critically influence whether an opsin absorbs maximally in the UV or violet range.

  • Evolutionary evidence: The replacement of ancestral UV opsin genes by violet opsin genes in some fish lineages demonstrates the selective advantage conferred by specific amino acid substitutions that shift absorption properties .

  • Chromophore environment: The electrostatic and hydrophobic interactions between specific amino acid residues and the retinal chromophore determine the energy required for photon absorption, thereby establishing the wavelength of maximum sensitivity.

  • Schiff base region: Amino acids near the Schiff base linkage between the chromophore and opsin protein particularly influence spectral tuning by affecting the electron distribution in the conjugated π-system of the retinal.

What assays can quantify G-protein activation by recombinant violet-sensitive opsin?

While specific assays for violet-sensitive opsin are not detailed in the search results, established methods for related opsins include:

  • GTPγS binding assay: Measures the rate of GDP-GTP exchange on G-protein α-subunits catalyzed by photoactivated opsin, typically using radiolabeled or fluorescent GTPγS.

  • GTPase activity assay: Quantifies the rate of GTP hydrolysis by G-protein α-subunits following activation by photoactivated opsin.

  • Comparative activation efficiency: Normalizing the activity of violet-sensitive opsin against well-characterized reference standards (e.g., bovine rhodopsin) provides meaningful comparisons across experiments .

For related opsins like TMT1A, researchers have found that Gi activation efficiency was approximately 10 times lower than bovine rhodopsin, while Go activation efficiency was comparable to rhodopsin .

How do violet-sensitive opsins contribute to visual processing in Oryzias latipes?

The functional role of violet-sensitive opsin within the visual system appears to be specialized:

  • Color discrimination: The violet-sensitive opsin likely contributes to color vision by providing sensitivity in the violet region of the spectrum, complementing blue (SWS2), green (RH2), and red (LWS) opsins.

  • Behavioral evidence: Studies with medaka lacking both violet (SWS1) and blue (SWS2) opsins show that these fish maintain normal or even enhanced optomotor responses under UV or blue light, indicating that violet opsin is not essential for basic motion detection .

  • Post-receptor processing: Research suggests that "RH2 and LWS, but not SWS1 and SWS2, predominantly contribute to the postreceptoral processes leading to the optomotor response or, possibly, to luminance detection in general" .

  • Functional analogy: This arrangement parallels the human visual system, where "medium-wavelength-sensitive and LWS cones, but not the SWS cones, are responsible for luminance detection" .

What methodological approaches can distinguish between basic photosensitivity and color-specific visual processing?

Researchers can employ several techniques to differentiate between these visual processes:

These approaches have revealed that in medaka, violet and blue opsins contribute minimally to basic motion detection, suggesting their primary role lies in color discrimination rather than luminance detection .

What evolutionary mechanisms drove the shift from UV to violet vision in teleost fish?

The evolutionary transition from UV to violet vision involved several processes:

  • Gene replacement: In some fish lineages, the ancestral UV opsin gene was completely replaced by the violet opsin gene, as evidenced by genomic analysis and Southern blot hybridization patterns .

  • Adaptive significance: This transition likely occurred in response to specific ecological pressures or changes in visual environments that made violet vision more advantageous than UV vision in certain habitats.

  • Molecular evidence: When fish genomic DNA was analyzed using SWS1 opsin cDNA probes under non-stringent conditions, some species showed hybridization patterns consistent with the presence of only violet-sensitive opsin genes, indicating complete replacement of the UV opsin gene .

  • Selective advantage: The widespread occurrence of this evolutionary shift across multiple lineages suggests significant adaptive value of violet vision in aquatic environments.

How do the spectral properties of Oryzias latipes violet-sensitive opsin compare with those of other vertebrates?

While direct spectral comparisons are not provided in the search results, general patterns in opsin evolution suggest:

  • Spectral diversity: Across vertebrates, SWS1 opsins show remarkable spectral diversity, with λmax values ranging from approximately 360 nm (UV-sensitive) to 440 nm (violet-sensitive).

  • Convergent evolution: The shift from UV to violet sensitivity has occurred independently in multiple vertebrate lineages, including various fish species and mammalian clades.

  • Ecological correlation: The distribution of UV versus violet sensitivity often correlates with habitat and ecological niche, with UV sensitivity common in shallow-water or surface-dwelling species and violet sensitivity more prevalent in deeper-water species.

  • Molecular basis: Similar amino acid substitutions often underlie these spectral shifts across distantly related lineages, demonstrating convergent molecular evolution.

What ecological advantages might violet vision confer in the natural habitat of Oryzias latipes?

The ecological significance of violet vision may include:

  • Habitat-specific adaptation: Violet light penetrates water more effectively than UV in certain aquatic environments, potentially making violet vision advantageous for detecting objects at greater depths.

  • Prey detection: Violet vision may enhance the detection of certain prey items or feeding opportunities that reflect or absorb light in this spectral range.

  • Predator avoidance: The ability to detect violet wavelengths might improve recognition of potential predators against various backgrounds.

  • Conspecific recognition: Violet-sensitive vision could facilitate recognition of conspecifics for social interactions or reproductive behaviors, particularly if medaka have reflectance patterns visible in this spectral range.

  • Functional redundancy: The finding that medaka lacking violet-sensitive opsin maintain behavioral photosensitivity suggests a system with some functional redundancy, potentially allowing adaptation to varying light environments.

What experimental design considerations are critical when studying recombinant violet-sensitive opsin photochemistry?

When designing experiments to characterize the photochemistry of recombinant violet-sensitive opsin, researchers should address:

  • Light exposure control: Maintain strict darkness during expression, purification, and handling to prevent unintended photoactivation. Use dim red light (>650 nm) for manipulation.

  • Temperature regulation: Conduct spectroscopic measurements at low temperatures (0°C) to stabilize photointermediates for detailed characterization of reaction kinetics .

  • Spectral range: Ensure spectrophotometric equipment covers both UV and visible ranges (300-700 nm) to capture the complete absorption spectrum and all potential photointermediates.

  • Sequential irradiation protocol: Design a systematic approach with monochromatic light sources matching absorption maxima to characterize the complete photocycle.

  • Time-resolved measurements: Implement rapid scanning or flash photolysis to capture short-lived photointermediates that may exist only transiently at physiological temperatures.

  • Sample purity verification: Confirm homogeneity of the reconstituted pigment through analytical techniques such as size-exclusion chromatography or SDS-PAGE before photochemical analysis.

How can researchers address contradictory findings in violet-sensitive opsin research?

When confronting contradictory results in the scientific literature, researchers should:

  • Methodological comparison: Carefully examine differences in expression systems, purification methods, detergent conditions, and spectroscopic techniques that might explain divergent findings.

  • Independent replication: Conduct experiments using multiple independent protein preparations and varied experimental approaches to establish reproducibility.

  • Opsin sequence verification: Confirm the complete amino acid sequence of the studied opsin, as small variations might significantly impact spectral and functional properties.

  • Environmental variables: Systematically investigate the effects of pH, ionic strength, temperature, and detergent composition on opsin properties, as these factors can substantially influence experimental outcomes.

  • Chromophore analysis: Verify the purity and isomeric state of the 11-cis-retinal used for reconstitution, as contamination with other retinal isomers can produce heterogeneous pigment populations.

  • Statistical rigour: Apply appropriate statistical methods to determine whether observed differences are significant or within the range of experimental variation.

What emerging technologies hold promise for advancing violet-sensitive opsin research?

Several cutting-edge approaches could significantly enhance our understanding of violet-sensitive opsins:

  • Cryo-electron microscopy (cryo-EM): This technique can reveal high-resolution structural details of opsin proteins in different conformational states without the need for crystallization.

  • Optogenetic applications: Violet-sensitive opsins could be engineered for optogenetic tools, allowing precise control of neural activity with violet light in experimental systems.

  • CRISPR/Cas9 genome editing: Creating precise modifications to the violet-sensitive opsin gene in vivo, similar to the approach used to generate sws1/sws2 double mutants , enables detailed functional analysis in the native context.

  • Single-molecule spectroscopy: This approach can reveal heterogeneity in molecular properties that might be obscured in ensemble measurements, providing insights into the conformational dynamics of individual opsin molecules.

  • Computational modeling: Advanced molecular dynamics simulations and quantum mechanical calculations can predict how specific amino acid substitutions affect spectral tuning and G-protein coupling efficiency.

  • Artificial intelligence applications: Machine learning algorithms can identify patterns in sequence-structure-function relationships across diverse opsins, potentially revealing new principles of spectral tuning.

How should spectral data from recombinant violet-sensitive opsin be analyzed and interpreted?

Rigorous analysis of spectral data requires:

  • Baseline correction: Properly subtract buffer/detergent backgrounds and correct for light scattering effects that can distort absorption spectra.

  • Spectral deconvolution: When multiple species are present (e.g., free retinal, properly folded opsin, photointermediates), mathematical deconvolution can separate overlapping spectral components.

  • Standardized reporting: Record and report complete experimental conditions including temperature, pH, detergent concentration, and protein concentration to enable cross-laboratory comparisons.

  • Difference spectroscopy: Calculate difference spectra between dark and light-exposed samples to visualize subtle spectral shifts that might be obscured in absolute spectra.

  • Temperature dependence: Analyze spectral properties across a range of temperatures to distinguish temperature-dependent conformational equilibria from distinct photochemical species.

  • Kinetic analysis: Fit time-dependent spectral changes to appropriate kinetic models to determine rate constants for photointermediate formation and decay.

What statistical approaches best analyze structure-function relationships in violet-sensitive opsin research?

Appropriate statistical methodologies include:

What are the most rigorous approaches for comparing G-protein activation across different opsin types?

Comprehensive comparative analysis requires:

  • Standardized assay conditions: Maintain identical experimental conditions (temperature, pH, ionic strength, G-protein concentration) when comparing different opsins.

  • Internal reference standards: Include well-characterized opsins (e.g., bovine rhodopsin) as internal standards in each experiment to normalize results across different preparations .

  • Concentration matching: Ensure equivalent concentrations of functional pigment for different opsin types being compared.

  • Multiple G-protein subtypes: Test activation of several G-protein subtypes (Gt, Gi, Go, Gq) to develop a comprehensive activation profile for each opsin .

  • Dose-response relationships: Measure activation across a range of opsin concentrations to determine both maximal activation rates and EC50 values.

  • Kinetic parameters: Analyze both initial rates and steady-state levels of G-protein activation to fully characterize the coupling efficiency.

  • Statistical validation: Apply appropriate statistical tests to determine whether observed differences in activation efficiency are significant across multiple independent experiments.

These approaches provide a rigorous framework for comparing the functional properties of violet-sensitive opsin with other visual and non-visual opsins in a scientifically sound manner.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.