Recombinant Oryzias latipes Red-sensitive opsin

Shipped with Ice Packs
In Stock

Description

Functional and Biochemical Properties

Spectral Tuning

  • Native Oryzias latipes red opsins (LWS-A and LWS-B) exhibit distinct absorption maxima due to amino acid substitutions in retinal-binding pockets. For example:

    • LWS-A: λ<sub>max</sub> ~560 nm

    • LWS-B: λ<sub>max</sub> ~530 nm .

  • The recombinant form likely mirrors these properties, enabling studies on spectral shifts and evolutionary diversification .

Photochemical Stability

  • Similar to other teleost opsins, the recombinant protein forms a stable 11-cis-retinal-bound state in darkness. Light exposure triggers isomerization to the all-trans active state, initiating G-protein signaling .

Research Applications

Mechanistic Studies

  • G-protein coupling: Acts as a Gi/Go-coupled receptor, analogous to TMT opsins in medaka, but with lower Gi activation efficiency compared to mammalian rhodopsins .

  • Retinal isomerization: Used to probe photo-conversion pathways (e.g., all-trans → 9-cis/7-cis states) under varying light conditions .

Evolutionary Biology

  • Comparative studies with zebrafish (Danio rerio) red opsins highlight convergent evolution in spectral tuning. For example, zebrafish LWS-1 and LWS-2 diverged via regulatory enhancers (e.g., LAR), whereas medaka subtypes arose via local gene duplication .

Technical Considerations

Limitations

  • Requires reconstitution with 11-cis-retinal for functional assays, complicating in vitro studies .

  • Lower expression yields in E. coli compared to mammalian systems .

Future Directions

  • Structural resolution: Cryo-EM or X-ray crystallography could elucidate binding pocket dynamics.

  • In vivo models: Transgenic medaka expressing recombinant opsins may clarify their role in behavioral adaptations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Red-sensitive opsin; KFH-R; Red cone photoreceptor pigment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Oryzias latipes (Japanese rice fish) (Japanese killifish)
Target Protein Sequence
MAEQWGKQVFAARRQNEDTTRGSAFTYTNSNHTRDPFEGPNYHIAPRWVYNLATLWMFFV VVLSVFTNGLVLVATAKFKKLRHPLNWILSNLAIADLGETVFASTISVCNQFFGYFILGH PMCVFEGYVVSTCGIAALWSLTIISWERWVVVCKPFGNVKFDAKWAIGGIVFSWVWSAVW CAPPVFGWSRYWPHGLKTSCGPDVFSGSDDPGVQSYMIVLMITCCIIPLAIIILCYLAVW LAIRAVAMQQKESESTQKAEREVSRMVVVMIVAYCVCWGPYTFFACFAAANPGYAFHPLA AAMPAYFAKSATIYNPVIYVFMNRQFRTCIMQLFGKQVDDGSEVSTSKTEVSSVAPA
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
The color pigments are found in the cone photoreceptor cells.

Q&A

What is Oryzias latipes Red-sensitive opsin and what is its role in visual perception?

Oryzias latipes (Japanese medaka) red-sensitive opsin is a G protein-coupled receptor that belongs to the opsin family of photoreceptor proteins. It is primarily expressed in cone photoreceptor cells in the retina and functions as a visual pigment sensitive to red wavelengths of light. Like other opsins, it contains a chromophore (typically 11-cis-retinal) that undergoes photoisomerization upon light absorption, triggering a signaling cascade that ultimately results in visual perception.

The protein consists of 357 amino acid residues and functions within the retinal cone mosaic, which is organized in a specific pattern in the medaka retina . Red-sensitive opsin (also categorized as a long-wavelength-sensitive opsin or LWS) works in conjunction with other visual pigments sensitive to different wavelengths to enable color vision in medaka fish.

How does the red-sensitive opsin function within the retinal architecture of Oryzias latipes?

In Oryzias latipes, red-sensitive opsin is part of a well-organized cone mosaic in the retina. The retina contains different cone cell types including short single cones (SSCs), long single cones (LSCs), and double cones, each expressing different opsin proteins. Red-sensitive opsin is typically found in one member of the double cones and/or in long single cones.

Unlike amphibians, which have specialized rod cells (red and green rods) expressing different visual pigments for scotopic vision , fish like medaka typically have a more conventional arrangement with one type of rod (expressing rhodopsin) and multiple cone types expressing different cone opsins including red-sensitive opsin.

What expression systems are most suitable for producing functional recombinant Oryzias latipes Red-sensitive opsin?

For structural and functional studies that require properly folded protein with post-translational modifications, mammalian cell lines (HEK293 or COS cells) or insect cell expression systems (Sf9 or Hi5 cells with baculovirus) may be more appropriate than bacterial systems. These eukaryotic systems provide the cellular machinery necessary for proper membrane protein folding and modification.

For high-throughput biochemical assays or antibody production, E. coli-based expression may be sufficient, particularly when using fusion tags (His, GST, MBP) to enhance solubility . When expressing in E. coli, consider using specialized strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)).

The choice of expression vector should include appropriate promoters (T7, CMV), fusion tags for purification, and potentially a cleavable signal peptide to direct the protein to the membrane or secretory pathway.

What purification strategies yield the highest purity and functionality for recombinant Red-sensitive opsin?

Purification of recombinant red-sensitive opsin requires specialized approaches due to its nature as a seven-transmembrane domain protein. Effective purification strategies include:

  • Affinity chromatography using immobilized metal affinity chromatography (IMAC) for His-tagged constructs , which is the most common first purification step

  • Detergent selection is critical - mild detergents like n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin help maintain protein structure and function

  • Size exclusion chromatography as a polishing step to separate monomeric from aggregated protein

  • For functional studies, reconstitution into nanodiscs or liposomes may preserve activity better than detergent micelles

A typical purification protocol would involve membrane isolation from expression host cells, solubilization in selected detergent, IMAC purification, and size exclusion chromatography. For fully functional protein, the chromophore (11-cis-retinal) may need to be added during or after purification.

What spectroscopic methods are most informative for characterizing Red-sensitive opsin function?

Several spectroscopic techniques can provide valuable information about the structure and function of red-sensitive opsin:

UV-Visible Absorption Spectroscopy: This fundamental technique allows determination of the absorption maximum (λmax) of the opsin-chromophore complex, which typically falls in the range of 560-580 nm for red-sensitive opsins. Spectral shifts upon light exposure can reveal information about photoisomerization kinetics and intermediates.

Circular Dichroism (CD): CD spectroscopy provides information about the secondary structure content and can be used to monitor thermal stability and proper folding of the recombinant protein.

Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence and fluorescence from attached probes can be used to monitor conformational changes upon chromophore binding or activation.

Retinal Exchange Assays: Similar to the methods used with amphibian visual pigments , researchers can measure the exchange rate of the chromophore (11-cis-retinal) with analogs like 9-cis-retinal to assess the openness of the binding pocket.

G Protein Activation Assays: Functional characterization can include measurement of G protein activation rates upon light stimulation, similar to methods used for determining thermal isomerization rates in other visual pigments .

How can researchers effectively develop and validate antibodies against Oryzias latipes Red-sensitive opsin?

Development of specific antibodies against red-sensitive opsin requires careful consideration of several factors:

Antigen Design: For polyclonal antibodies, using purified full-length recombinant protein is ideal but challenging. Alternatively, synthetic peptides corresponding to unique extracellular or C-terminal regions of the opsin can be used. For monoclonal antibodies, similar to the approach used for SWS1 , specific epitopes unique to red-sensitive opsin should be targeted.

Validation Strategy:

  • Western blotting against recombinant protein and medaka retinal tissue lysates

  • Immunohistochemistry on wild-type retinal sections with appropriate controls

  • Testing on opsin-mutant fish (similar to sws1-mutant strategy ) to confirm specificity

  • Cross-reactivity testing against other opsins to ensure specificity

  • Preabsorption controls with the immunizing antigen

Application Optimization:
For immunohistochemistry, optimize fixation methods (typically 4% paraformaldehyde), antigen retrieval if needed, and blocking conditions to minimize background. For best results in retinal sections, consider using thin (5-10 μm) cryosections and comparing results with established antibodies like ZPR1, which recognizes arrestin in double cones and long single cones .

How can thermal stability and dark adaptation be measured for Red-sensitive opsin?

Thermal stability of red-sensitive opsin is a crucial property that affects its function in visual perception. Advanced methodological approaches include:

Thermal Isomerization Rate Measurement: Using biochemical G-protein activation assays similar to those employed for amphibian visual pigments . The process involves measuring:

  • Dark activity (vdark) of the pigment in activating G proteins

  • Light-activated activity (vlight) after illumination

  • Decay rate (kd) of the active metarhodopsin state

From these parameters, the thermal isomerization rate (kth) can be calculated using the formula:
kth=vdark×kdvlightk_{th} = \frac{v_{dark} \times k_d}{v_{light}}

Differential Scanning Fluorimetry (DSF): This technique measures the unfolding temperature (Tm) of the protein as an indicator of thermal stability. By monitoring fluorescence of a reporter dye (like SYPRO Orange) that binds to hydrophobic regions exposed during unfolding, researchers can determine the temperature at which the protein denatures.

Comparative Analysis: Comparing the thermal stability of red-sensitive opsin to other opsins from the same species (SWS1, SWS2, rhodopsin) can provide insights into evolutionary adaptations for specific visual environments.

What CRISPR/Cas9 strategies are most effective for generating Red-sensitive opsin mutants in medaka?

Based on successful approaches used for creating sws1-mutant medaka , the following CRISPR/Cas9 methodologies are recommended for generating red-sensitive opsin mutants:

Target Selection:

  • Design sgRNAs targeting early exons of the red-sensitive opsin gene to ensure complete loss of function

  • Select targets with high on-target and low off-target scores using tools like CRISPOR or CHOPCHOP

  • Consider targeting conserved functional domains such as the chromophore binding pocket or G-protein interaction sites

Delivery Method:

  • Microinjection of Cas9 protein and sgRNA into one-cell stage medaka embryos

  • Alternative: injection of Cas9 mRNA and sgRNA for longer Cas9 expression

Mutation Screening and Validation:

  • T7 endonuclease I assay or heteroduplex mobility assay for initial screening

  • Targeted sequencing of the modified region to identify specific mutations

  • Western blotting and immunohistochemistry using anti-red-sensitive opsin antibodies to confirm protein loss

  • Spectroscopic analysis of isolated retinas to confirm functional effects

  • Establishing stable mutant lines through selective breeding

Phenotypic Characterization:
Unlike sws1 mutants which retained normal cone mosaic structure , red-sensitive opsin mutants should be carefully examined for changes in:

  • Retinal architecture using histological methods

  • Cone cell morphology and arrangement

  • Expression of other opsin genes (potential compensatory mechanisms)

  • Visual function through behavioral assays

How does Oryzias latipes Red-sensitive opsin compare to visual pigments in other species?

Red-sensitive opsin in Oryzias latipes can be compared to other visual pigments through several analytical approaches:

Sequence Alignment and Phylogenetic Analysis:
Alignment of the amino acid sequence with other fish red-sensitive opsins reveals conservation patterns, especially in key functional regions like the chromophore binding pocket. Unlike amphibians, which show specialized adaptations like the mutation at position 47 in blue-sensitive cone pigments of Anura that reduces thermal isomerization rates , fish red-sensitive opsins typically maintain higher thermal isomerization rates characteristic of cone pigments.

Spectral Tuning Sites:
Specific amino acid positions known as "spectral tuning sites" determine the wavelength of maximum absorption. Comparative analysis of these sites between medaka and other species can reveal the molecular basis for spectral sensitivity differences. This is particularly relevant when comparing fish adapted to different light environments (shallow vs. deep water, clear vs. turbid habitats).

Functional Divergence:
While amphibians have evolved unique adaptations like having both red rods (with rhodopsin) and green rods (with blue-sensitive cone pigment) for scotopic vision , teleost fish like medaka have a different visual system organization. Understanding these differences through comparative analysis provides insights into the evolutionary pressures shaping visual systems.

What methodologies are most effective for studying opsin gene regulation during medaka development?

Investigating developmental regulation of red-sensitive opsin expression requires sophisticated molecular and imaging techniques:

Temporal Expression Analysis:

  • Quantitative PCR (qPCR) at different developmental stages to track mRNA expression levels

  • RNA-seq for genome-wide transcriptional profiling during retinal development

  • In situ hybridization to visualize spatial expression patterns in developing retina

Regulatory Element Identification:

  • Promoter analysis using reporter constructs (similar to the transgenic approach used for sws1 )

  • ATAC-seq to identify open chromatin regions near the opsin gene

  • ChIP-seq to identify transcription factor binding sites and histone modifications

Transgenic Reporter Systems:
Creating transgenic lines with fluorescent reporters (e.g., EGFP) under the control of the red-sensitive opsin promoter, similar to the Tg(sws1:mem-egfp) approach . This allows visualization of:

  • Temporal onset of expression

  • Spatial patterns within the developing retina

  • Cell-type specificity

  • Response to environmental factors (light conditions, temperature)

Environmental Influence Studies:
Experimental manipulation of light conditions (spectrum, intensity, photoperiod) during development to assess phenotypic plasticity in opsin expression, which may provide insights into evolutionary adaptations to various light environments.

What are the most common technical challenges in working with recombinant Red-sensitive opsin and how can they be addressed?

Researchers working with recombinant red-sensitive opsin commonly encounter several technical challenges:

Protein Stability Issues:

  • Challenge: Membrane proteins like opsins often denature during expression and purification

  • Solution: Include stabilizing agents such as glycerol (10-20%), specific lipids, or cholesterol in buffers; consider using thermostabilizing mutations identified through alanine scanning

Low Expression Yields:

  • Challenge: Membrane protein overexpression can be toxic to host cells

  • Solution: Use tunable expression systems with lower induction levels; optimize codon usage for the host organism; try fusion partners known to enhance expression (BRIL, T4 lysozyme)

Chromophore Stability:

  • Challenge: 11-cis-retinal is light-sensitive and can isomerize during handling

  • Solution: Work under dim red light conditions; store chromophore and reconstituted protein samples in light-protected containers; consider using more stable analogs like 9-cis-retinal for certain applications

Functional Assay Sensitivity:

  • Challenge: Detecting the relatively small signal changes in spectroscopic assays

  • Solution: Increase protein concentration; use highly sensitive instruments; compare results with positive controls such as bovine rhodopsin; implement signal averaging techniques

How can researchers distinguish between artifacts and genuine results when analyzing Red-sensitive opsin function?

Distinguishing artifacts from genuine results requires rigorous experimental design and appropriate controls:

Essential Controls for Spectroscopic Studies:

  • Empty vector/uninduced culture controls processed identically to experimental samples

  • Heat-denatured protein samples to establish baseline for non-specific effects

  • Bleached samples (light-exposed) to confirm spectral changes are due to chromophore isomerization

  • Multiple preparation batches to ensure reproducibility

Validation Through Multiple Methodologies:
Cross-validate findings using different techniques. For example, if a spectral shift is observed through absorption spectroscopy, confirm with circular dichroism or fluorescence measurements.

Artifact Identification Table:

Common ArtifactPotential CauseIdentification MethodPreventive Measure
False spectral peaksSample turbidityCheck baseline stability; measure at multiple protein concentrationsCentrifuge samples before measurement; adjust detergent concentration
Inconsistent λmax valuesIncomplete chromophore bindingCompare with literature values; check chromophore:protein ratioOptimize reconstitution protocol; extend incubation time
Non-specific antibody bindingCross-reactivityTest on knockout/mutant samples Include additional blocking steps; validate with peptide competition
Abnormal G-protein activationPresence of contaminant proteinsRun SDS-PAGE to check purity; measure activation with varying protein concentrationsImplement additional purification steps

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.