Recombinant Oryzias latipes Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin; KFH-RH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Oryzias latipes (Japanese rice fish) (Japanese killifish)
Target Names
rho
Target Protein Sequence
MNGTEGPYFNVPMVNTTGIVRSPYEYPQYYLVSPAAYAALGAYMFFLILVGFPINFLTLY VTLEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIGLWSLVVLAIERWVVVCKPISNFRFGENHAIMGLVFTWIMAASCAVPPLVGWSRYIP EGMQCSCGVDYYTRAEGFNNESFVVYMFVCHFLIPLIVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVTRMVVIMVIGFLVCWLPYASVAWYIFTNQGSEFGPLFMTIPAFFAKSSSI YNPAIYICMNKQFRNCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision under low light conditions. While most saltwater fish species utilize retinal as their chromophore, most freshwater fish employ 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the evolutionary relationship between intron-containing and intron-less rhodopsin genes in Oryzias latipes?

Oryzias latipes, like other teleost fish, possesses both intron-containing and intron-less rhodopsin genes that evolved through a process of gene duplication. The intron-less rhodopsin genes originated through retroduplication from ancestral intron-containing rhodopsin genes . Phylogenetic analyses reveal that this retroduplication event occurred after the divergence of the Polypteriformes lineage (bichirs) but before the emergence of teleosts . In teleosts, including Oryzias latipes, the intron-containing rhodopsin (known as exo-rhodopsin) is primarily expressed in the pineal gland, while the intron-less rhodopsin is predominantly expressed in the retina .

How does Oryzias latipes rhodopsin expression pattern differ from other fish species?

In Oryzias latipes, as in other teleosts, there is a distinct tissue-specific expression pattern of rhodopsin genes. Based on comparative studies, the intron-less rhodopsin is abundantly expressed in retinal photoreceptor cells, while the intron-containing rhodopsin (exo-rhodopsin) is exclusively expressed in the pineal gland . This differs from pre-teleost fishes like spotted gar, where both rhodopsin genes show expression in the retina, with intron-less rhodopsin being the predominant form, and only weak expression of intron-containing rhodopsin in the pineal gland . In more basal species like bichir, only the intron-containing rhodopsin is expressed in the retina with no expression in the pineal gland .

What are the spectral characteristics of Oryzias latipes rhodopsin?

Like most vertebrate rhodopsins, Oryzias latipes rhodopsin has an absorption maximum (λmax) around 500 nm . This is consistent with other fish rhodopsins from gray bichir, reedfish, Siberian sturgeon, and spotted gar, which also show λmax values of approximately 500 nm when reconstituted with 11-cis form of A1 retinal . These spectral properties reflect the evolutionary conservation of key amino acid residues that interact with the chromophore in the rhodopsin binding pocket.

How does the opsin gene repertoire in Oryzias latipes compare to other vertebrates?

Oryzias latipes possesses a diverse cone opsin repertoire consisting of eight genes: two red (LWS), three green (RH2), two blue (SWS2), and one violet (SWS1) . This extensive repertoire allows medaka to have a broad spectral sensitivity range from 356 nm to 562 nm . In comparison to other vertebrates, this represents an expanded opsin repertoire, as many mammals have lost several of these opsin types during evolution . The diversity of opsins in Oryzias latipes provides an excellent model for studying the evolution and functional differentiation of visual pigments.

What methodologies are optimal for expressing and purifying recombinant Oryzias latipes rhodopsin?

For successful expression and purification of recombinant Oryzias latipes rhodopsin, researchers should consider the following methodological approach:

  • Gene amplification: Utilize RT-PCR on eye RNA with primers designed based on conserved regions of teleost rhodopsins . For full-length ORF amplification, design primers that span the entire coding sequence (approximately 1,060 bp for intron-less rhodopsin) .

  • Expression vector construction: Clone the amplified rhodopsin cDNA into a mammalian expression vector such as pcDNA3.1 with appropriate epitope tags for detection and purification .

  • Heterologous expression: Express the recombinant protein in HEK293 cells, which provide the necessary machinery for proper folding and post-translational modifications of membrane proteins .

  • Reconstitution: Reconstitute the expressed protein with 11-cis-retinal under dim red light conditions to form functional rhodopsin .

  • Purification: Utilize affinity chromatography based on the epitope tag, followed by size exclusion chromatography to obtain pure, functional rhodopsin .

This methodology has been successfully employed for various fish rhodopsins and should be effective for Oryzias latipes rhodopsin as well.

How can researchers accurately characterize the spectral properties of recombinant Oryzias latipes rhodopsin?

To accurately characterize the spectral properties of recombinant Oryzias latipes rhodopsin, researchers should implement the following protocol:

  • Sample preparation: Purify reconstituted rhodopsin in a detergent solution that maintains protein stability, such as n-dodecyl-β-D-maltoside (DDM) .

  • Absorption spectroscopy: Measure the absorption spectrum of dark-adapted rhodopsin between 250 and 700 nm using a spectrophotometer with temperature control (typically at 20°C) .

  • Photobleaching experiments: Expose the sample to light at the λmax wavelength and measure subsequent spectra to characterize the photoproducts and confirm photoactivity .

  • Meta II intermediate kinetics: Monitor the formation and decay of the meta II intermediate after photoactivation using time-resolved spectroscopy at approximately 380 nm . This is particularly important as the meta II decay rate differs between retinal and pineal rhodopsins, with pineal rhodopsins typically showing faster decay rates .

  • Data analysis: Calculate the λmax using the method of Govardovskii et al. for fitting visual pigment templates to the recorded absorbance data .

These methods have been successfully used to characterize fish rhodopsins with absorption maxima around 500 nm.

What are the implications of gene duplication and conversion events in the evolution of Oryzias latipes rhodopsin genes?

Gene duplication and conversion events have played critical roles in shaping the rhodopsin gene repertoire in Oryzias latipes. The evidence from long-wavelength sensitive (LWS) genes in medaka provides insights applicable to rhodopsin evolution :

  • Functional redundancy: Gene duplication often initially results in functional redundancy, as observed in LWS genes of Oryzias latipes . Similarly, redundancy in rhodopsin genes may provide genetic backup that ensures visual function is maintained even if one copy is mutated.

  • Gene conversion: Non-allelic gene conversion can homogenize paralogous sequences, as demonstrated in LWS genes . This mechanism may temporarily reduce genetic diversity before eventual loss of redundant copies or functional divergence.

  • Evolutionary trajectory: The study of LWS genes indicates that redundant copies may eventually be lost or evolve new functions . This evolutionary pattern likely applies to rhodopsin genes as well, with temporal specialization (retinal vs. pineal expression) representing one outcome of functional divergence.

  • Phylogenetic implications: Gene conversion events can complicate phylogenetic analyses by creating an appearance of recent duplication when the actual duplication event occurred much earlier . This should be considered when studying the evolutionary history of rhodopsin genes in fish.

Understanding these processes is essential for correctly interpreting the evolutionary history of visual pigments in Oryzias latipes and other teleosts.

How can CRISPR-Cas9 genome editing be applied to study rhodopsin function in Oryzias latipes?

CRISPR-Cas9 genome editing offers powerful approaches to study rhodopsin function in Oryzias latipes:

  • Knockout models: Design sgRNAs targeting conserved regions of rhodopsin genes to create knockout models that can reveal the phenotypic consequences of rhodopsin deficiency .

  • Paralog-specific targeting: As demonstrated in the study of LWS genes, it is possible to target specific paralogs to assess their individual contributions to visual function . This approach can help determine whether retinal and pineal rhodopsins have distinct or overlapping functions.

  • Reporter gene knock-in: Insert fluorescent reporter genes in-frame with rhodopsin genes to visualize expression patterns without disrupting protein function .

  • Point mutations: Introduce specific amino acid substitutions to investigate structure-function relationships, particularly those affecting spectral tuning or G-protein interaction .

  • Validation methods: Confirm genomic modifications using PCR, sequencing, and functional assays such as electroretinography to assess visual function .

The feasibility of this approach is supported by successful application in studying other opsin genes in medaka, where mutants with single LWS genes showed no defects in expression or behavioral red-light sensitivity, demonstrating functional redundancy of the paralogs .

What molecular mechanisms account for the functional differences between retinal and pineal rhodopsins in teleosts?

The functional specialization of rhodopsins in teleosts, including Oryzias latipes, is primarily attributed to the following molecular mechanisms:

  • Meta II intermediate decay rates: The meta II intermediate of pineal rhodopsin (exo-rhodopsin) decays faster than that of retinal rhodopsin . This property is similar to cone visual pigments and facilitates rapid bleach recovery under continuous bright light conditions experienced by the pineal gland .

  • Expression regulation: The tissue-specific expression patterns evolved after the retroduplication event, with regulatory elements directing the expression of intron-containing rhodopsin to the pineal gland and intron-less rhodopsin to the retina in teleosts .

  • Protein sequence adaptations: Though sharing high sequence similarity, subtle amino acid differences between retinal and pineal rhodopsins likely contribute to their functional specialization, particularly in regions involved in G-protein coupling and metarhodopsin stability .

  • Evolution of optimized function: The abundant and exclusive expression of intron-containing rhodopsin in the pineal gland was achieved after the branching of the gar lineage, representing a stepwise evolution toward specialized photoreceptive functions .

These differences highlight the evolutionary adaptation of duplicate rhodopsin genes to serve distinct photoreceptive functions in teleost fishes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.