Recombinant Oryzomys albigularis NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oryzomys albigularis NADH-Ubiquinone Oxidoreductase Chain 4L (MT-ND4L)

Recombinant Oryzomys albigularis NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a laboratory-engineered protein derived from the mitochondrial genome of Oryzomys albigularis, a rodent species. This protein is a subunit of Complex I (NADH dehydrogenase), a critical component of the mitochondrial electron transport chain responsible for transferring electrons from NADH to ubiquinone while pumping protons across the inner mitochondrial membrane . Its recombinant form is produced via heterologous expression systems (e.g., E. coli, yeast, or mammalian cells) for research into mitochondrial dysfunction, metabolic disorders, and disease mechanisms .

Production and Applications

Expression Systems
Recombinant MT-ND4L is produced using diverse systems to optimize yield and structural integrity:

  1. Bacterial Systems (E. coli):

    • Advantages: High yields, low cost, and rapid production .

    • Limitations: May lack post-translational modifications critical for function .

  2. Yeast Systems (Pichia canadensis):

    • Advantages: Proper folding and disulfide bond formation .

  3. Mammalian Systems:

    • Used for studies requiring human-like glycosylation or membrane integration .

Research Applications

  • Complex I Assembly Studies: Used to investigate subunit interactions and assembly pathways .

  • Disease Modeling: Tested in models of Leber’s Hereditary Optic Neuropathy (LHON) and metabolic disorders linked to Complex I dysfunction .

  • Enzyme Inhibition Studies: Assayed for resistance to Complex I inhibitors like rotenone .

Clinical and Pathological Relevance

Role in Disease

  • Leber’s Hereditary Optic Neuropathy (LHON): A T10663C mutation in MT-ND4L (Val65Ala) disrupts Complex I activity, leading to ATP depletion and retinal ganglion cell death .

  • Metabolic Disorders: Variants associated with obesity, diabetes, and hypertension due to impaired oxidative phosphorylation .

Therapeutic Potential
Recombinant MT-ND4L is explored in gene therapy to bypass mitochondrial Complex I defects. For example:

  • Single-Subunit Replacement: Inspired by Saccharomyces cerevisiae Ndi1, which compensates for Complex I loss in mammalian cells .

  • Protein Replacement Therapy: His-tagged MT-ND4L may enable targeted delivery or purification in therapeutic formulations .

Data Tables and Research Findings

Table 1: Recombinant MT-ND4L from Diverse Hosts

Host OrganismSourcePurityTaggingApplication Notes
E. coli ≥85%His-tagHigh-yield production, structural studies
Yeast ≥85%His-tagProper folding, disulfide bond formation
Mammalian ≥85%N/AFunctional assays requiring post-translational modifications

Table 2: Functional and Clinical Insights

ParameterDetailsSource
Electron TransferTransfers electrons from NADH to ubiquinone; pumps 4 H⁺ per cycle
LHON MutationT10663C (Val65Ala) impairs Complex I activity, linked to optic atrophy
Therapeutic UseTested in adeno-associated virus vectors for neurodegenerative diseases

Future Directions

  1. Structural Biology: Cryo-EM studies to resolve MT-ND4L’s role in Complex I’s transmembrane architecture.

  2. Gene Therapy: Optimization of recombinant MT-ND4L delivery for mitochondrial disorders.

  3. Cross-Species Studies: Comparative analysis with human MT-ND4L to identify conserved and divergent functional motifs.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize development according to your specifications.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Nephelomys albigularis (Tomes's rice rat) (Oryzomys albigularis)
Target Names
Target Protein Sequence
MSPIYINLMMAFIFSLLGTLLFRSHLMSTLLCLEGMMLSLFIMVTSSALNTQSMITYVIP ITMLVFGACEAAIGLALLVMISNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of MT-ND4L in mitochondrial metabolism?

MT-ND4L gene provides instructions for producing NADH dehydrogenase 4L protein, which serves as an essential component of mitochondrial complex I (NADH:ubiquinone oxidoreductase). This protein participates in the first step of the electron transport chain during oxidative phosphorylation, specifically facilitating electron transfer from NADH to ubiquinone. Through this process, MT-ND4L contributes to establishing the electrochemical gradient across the inner mitochondrial membrane that ultimately drives ATP production, the primary energy currency of cells .

The methodological approach to studying this function typically involves isolated mitochondria experiments, measuring oxygen consumption rates, membrane potential, and specific complex I activity through spectrophotometric assays using NADH oxidation as a readout. Researchers should consider employing both in vitro reconstitution experiments and cellular respiration studies to comprehensively characterize MT-ND4L functional contributions.

How does the structural conformation of MT-ND4L contribute to complex I assembly and stability?

Current structural models of MT-ND4L, such as those derived from AlphaFold computational predictions, indicate a highly conserved transmembrane protein with distinct hydrophobic domains that anchor it within the inner mitochondrial membrane. The protein demonstrates a high confidence score (pLDDT: 91.97) in structural predictions, suggesting reliable tertiary structure determination despite the challenges associated with membrane protein crystallization .

To investigate MT-ND4L's contribution to complex I assembly, researchers should implement blue native polyacrylamide gel electrophoresis (BN-PAGE) combined with western blotting using antibodies specific to multiple complex I subunits. Additionally, proximity labeling approaches such as BioID or APEX2 can identify direct interaction partners. Pulse-chase experiments with radiolabeled amino acids can further elucidate the temporal sequence of assembly steps involving MT-ND4L.

What are the optimal expression systems for producing recombinant Oryzomys albigularis MT-ND4L?

Expression of mitochondrially-encoded membrane proteins like MT-ND4L presents significant technical challenges. For recombinant expression of Oryzomys albigularis MT-ND4L specifically, researchers should consider:

  • Bacterial expression systems: E. coli strains (C41/C43) engineered for membrane protein expression, with codon optimization for the target gene

  • Yeast expression: Pichia pastoris offers advantages for mitochondrial membrane proteins due to its eukaryotic translation machinery

  • Mammalian cell lines: HEK293 or CHO cells with inducible expression systems to minimize toxicity

The protein should be tagged with a purification handle (His6, FLAG, etc.) positioned to minimize interference with protein folding. Expression conditions requiring optimization include induction temperature (typically lower temperatures of 16-20°C), induction duration, and membrane-mimicking environments during purification (detergents such as DDM, LMNG, or reconstitution into nanodiscs).

What techniques are most effective for analyzing MT-ND4L variants and their impact on complex I function?

When investigating MT-ND4L variants, particularly those associated with pathological conditions such as the Val65Ala mutation linked to Leber hereditary optic neuropathy , researchers should implement a multi-tiered analytical approach:

TechniqueApplicationAdvantagesLimitations
Site-directed mutagenesisIntroduction of specific variantsPrecisely targeted changesRequires good expression system
RespirometryMeasure oxygen consumptionDirect functional assessmentRequires intact mitochondria
BN-PAGEComplex I assembly analysisPreserves native complexesSemi-quantitative
Hydrogen-deuterium exchange MSConformational changesHigh resolution structural insightsTechnically demanding
Cryo-EMStructural impact of variantsNear-atomic resolutionChallenging for single subunit analysis

The integration of these techniques allows for comprehensive characterization of how specific amino acid substitutions affect both the structure and function of MT-ND4L within the larger complex I framework. Particular attention should be paid to electron transfer kinetics, proton pumping efficiency, and ROS production in variant forms.

How is MT-ND4L implicated in neurodegenerative disorders, particularly Alzheimer's disease?

Recent whole exome sequencing studies from the Alzheimer's Disease Sequencing Project have identified a significant association between a rare MT-ND4L variant (rs28709356 C>T, minor allele frequency = 0.002) and Alzheimer's disease risk (P = 7.3 × 10⁻⁵). The gene-based analysis also showed significant association (P = 6.71 × 10⁻⁵), suggesting MT-ND4L dysfunction may contribute to AD pathogenesis .

Researchers investigating this connection should employ:

  • Patient-derived fibroblasts or iPSCs carrying the variant for functional studies

  • Transgenic animal models (including appropriate rodent models) expressing the variant

  • Mitochondrial functional assessments focusing on:

    • Bioenergetic profiling (Seahorse XF analysis)

    • ROS production measurement

    • Calcium homeostasis

    • Mitochondrial dynamics (fission/fusion balance)

Correlative studies should examine the relationship between MT-ND4L variants and established AD biomarkers, including amyloid-β accumulation, tau hyperphosphorylation, and synaptic density. Advanced microscopy techniques such as super-resolution imaging can help visualize mitochondrial morphology changes in neurons expressing variant MT-ND4L.

What is the relationship between MT-ND4L mutations and Leber hereditary optic neuropathy?

The T10663C (Val65Ala) mutation in MT-ND4L has been identified in several families with Leber hereditary optic neuropathy (LHON), a condition characterized by bilateral vision loss due to retinal ganglion cell degeneration . While the exact pathomechanism remains incompletely understood, impaired complex I function appears central to disease progression.

To investigate this relationship, researchers should:

  • Establish cellular models using patient-derived cells or CRISPR-engineered cell lines carrying the mutation

  • Assess retinal ganglion cell-specific vulnerability through differentiated iPSCs

  • Measure complex I-specific activity, ATP production, and ROS levels

  • Examine retrograde signaling from compromised mitochondria to the nucleus

  • Evaluate anterograde axonal transport of mitochondria in neuronal models

Therapeutic development approaches might include:

  • Small molecules enhancing residual complex I activity

  • Alternative electron transfer pathways bypassing complex I

  • Mitochondrial-targeted antioxidants

  • Gene therapy approaches to deliver wild-type MT-ND4L to affected tissues

How can researchers effectively model MT-ND4L dysfunction in animal systems to study mitochondrial disease?

Animal modeling of MT-ND4L dysfunction presents unique challenges due to the mitochondrial genome location of this gene. Researchers should consider:

  • Cybrid models: Transferring mitochondria containing the mutation of interest into ρ⁰ cells (cells depleted of mitochondrial DNA)

  • Heteroplasmy models: Creating animals with mixed populations of wild-type and mutant mitochondria

  • Conditional expression systems: Using nuclear-encoded, mitochondrially-targeted recombinant versions with controllable expression

  • Rice rat models: Leveraging natural Oryzomys albigularis systems for MT-ND4L research, particularly for tissue-specific effects

For rice rat models specifically, researchers must carefully consider dietary conditions, as demonstrated in study where specialized high-sucrose diets were employed to exacerbate conditions in rodent models. When using such models for MT-ND4L studies, appropriate controls and standardized husbandry conditions are essential for reproducible results.

Phenotypic assessment should incorporate:

  • Comprehensive metabolic profiling

  • Tissue-specific bioenergetic analysis

  • Behavioral testing for subtle neurological deficits

  • Longitudinal studies capturing age-related progression

  • Histological examination of tissues with high energy demands

What are the cutting-edge approaches for investigating the interaction between MT-ND4L and nuclear-encoded mitochondrial proteins?

The mitochondrial-nuclear crosstalk, particularly involving MT-ND4L and its nuclear-encoded interaction partners, represents a frontier in mitochondrial research. Advanced methodologies include:

  • Proximity labeling proteomics: Employing BioID or APEX2 fusions to identify proteins in close proximity to MT-ND4L

  • Mitochondrial-targeted CRISPR screens: Identifying nuclear genes that synthetically interact with MT-ND4L variants

  • Multi-omics integration: Combining proteomics, metabolomics, and transcriptomics data to map pathway perturbations

  • Cryo-electron tomography: Visualizing MT-ND4L in situ within intact mitochondrial membranes

  • Single-cell analyses: Characterizing cell-to-cell variability in mitochondrial function related to MT-ND4L expression

Research in this area should focus on the assembly factors and chaperones that facilitate the incorporation of MT-ND4L into complex I, as well as how nuclear-encoded complex I components adapt to MT-ND4L variants. The interplay between MT-ND4L and nuclear genes like TAMM41, which has shown significant association with Alzheimer's disease in mitochondrial-focused genetic studies , merits particular attention.

What are the best practices for isolating and analyzing mitochondrial fractions to study MT-ND4L?

Effective isolation and analysis of mitochondrial fractions for MT-ND4L studies require careful attention to methodology:

StepProcedureCritical Considerations
Tissue/cell preparationMechanical homogenization or chemical lysisGentle disruption to preserve mitochondrial integrity
Differential centrifugationSequential spins (600g, 7000g, 20000g)Temperature control (4°C) throughout process
Density gradient purificationPercoll or sucrose gradientsEssential for high-purity preparations
Mitoplast preparationControlled osmotic shockRequired for inner membrane protein access
SubfractionationDetergent-based separationDetergent selection critical for complex I integrity

For specific MT-ND4L analysis, researchers should:

  • Employ antibodies validated for the specific species (Oryzomys albigularis) or use conserved epitope antibodies

  • Consider targeted mass spectrometry approaches for precise quantification

  • Implement blue native electrophoresis to assess incorporation into complex I

  • Use appropriate controls for mitochondrial purity (markers for different cellular compartments)

How can researchers effectively design primers and probes for MT-ND4L sequence analysis across species?

When designing primers and probes for MT-ND4L sequence analysis, particularly when working with less common species like Oryzomys albigularis, researchers should:

  • Perform comprehensive sequence alignment: Compare MT-ND4L sequences across related species to identify conserved regions

  • Target conserved regions: Design primers in regions with high sequence conservation

  • Account for codon bias: Mitochondrial genetic code differs from the standard genetic code, requiring appropriate translation considerations

  • Use degenerate primers: For cross-species applications where exact sequences are uncertain

  • Validate amplification specificity: Through sequencing of PCR products from new species

For specific applications:

  • qPCR measurement: Design hydrolysis probes spanning exon-exon boundaries for transcript quantification

  • Mutation screening: Design primers that create or destroy restriction sites at mutation loci

  • Long-range PCR: Use high-fidelity polymerases with proofreading capability

  • NGS library preparation: Consider unique mitochondrial DNA characteristics such as circular topology

What are the emerging research directions for MT-ND4L in comparative mitochondrial biology?

The study of MT-ND4L across different species, particularly comparing model organisms like Oryzomys albigularis with human systems, represents an important frontier in comparative mitochondrial biology. Future research should focus on:

  • Understanding species-specific adaptations in MT-ND4L structure and function, particularly in organisms with different metabolic demands

  • Investigating the co-evolution of mitochondrial and nuclear genomes in shaping complex I function

  • Exploring the role of MT-ND4L variants in species-specific susceptibility to neurodegenerative diseases

  • Developing cross-species conservation maps to identify functionally critical domains

  • Leveraging phylogenetic approaches to predict the pathogenicity of novel variants

Researchers should employ both computational approaches (molecular dynamics simulations, evolutionary rate analysis) and experimental comparative studies to advance understanding in this field. The integration of findings from diverse species will provide deeper insights into the fundamental roles of MT-ND4L in bioenergetics and disease.

How might MT-ND4L research inform future therapeutic strategies for mitochondrial disorders?

Research on MT-ND4L has significant implications for developing therapeutic approaches for mitochondrial disorders, particularly those affecting complex I function. These strategies include:

  • Gene therapy approaches: Delivering wild-type MT-ND4L to affected tissues, potentially using adeno-associated viral vectors

  • Allotopic expression: Expressing mitochondrially-encoded genes from the nucleus with mitochondrial targeting sequences

  • Small molecule modulators: Developing compounds that specifically enhance residual complex I activity or provide alternative electron routes

  • Mitochondrial replacement therapy: For germline prevention of mitochondrial disease transmission

  • Metabolic bypasses: Providing alternative substrates that can enter the respiratory chain downstream of complex I

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.