Recombinant Oryzomys palustris NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant MT-ND3 is produced using recombinant DNA technology, enabling large-scale expression in systems like E. coli . Key properties include:

ParameterDetails
Source SpeciesOryzomys palustris (Marsh rice rat)
UniProt IDO21560
Amino Acid Sequence1–115 residues (Full-length)
Molecular Weight~13 kDa (predicted)
Expression TagHis-tag (varies by production protocol)
Storage ConditionsTris/PBS-based buffer with 50% glycerol; store at -20°C/-80°C

The protein retains the conserved structural motifs of ND3, including hydrophobic transmembrane domains essential for anchoring Complex I into the mitochondrial inner membrane .

Functional Role in Mitochondrial Complex I

MT-ND3 is a core subunit of NADH dehydrogenase (Complex I), which facilitates electron transfer from NADH to ubiquinone, coupled with proton pumping across the mitochondrial membrane . Key functional features include:

  • Catalytic Activity: Critical for NADH binding and electron transfer via FMN and iron-sulfur clusters .

  • Pathogenic Variants: Mutations in MT-ND3 are linked to mitochondrial disorders such as Leigh syndrome and MELAS (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes) .

Research Applications

Recombinant MT-ND3 is utilized in:

  • Antibody Development: Rabbit polyclonal antibodies (e.g., ab204977) are validated for immunohistochemistry (IHC) and immunofluorescence (IF) in human tissues .

  • Enzyme Activity Studies: Used to investigate Complex I dysfunction in mitochondrial diseases .

  • Structural Biology: Assists in mapping transmembrane domains and interaction sites (e.g., with APP and NDUFA9) .

Pathogenic and Clinical Relevance

The 10197G>A mutation in MT-ND3 is associated with:

  • Leigh Syndrome: Neurodegeneration with onset in infancy, linked to Complex I deficiency .

  • Dystonia: Heteroplasmic mutations correlate with movement disorders .

  • LHON (Leber’s Hereditary Optic Neuropathy): Rarely reported but implicated in optic nerve degeneration .

Technical Notes for Experimental Use

  • Reconstitution: Lyophilized proteins should be dissolved in deionized water with 5–50% glycerol to prevent aggregation .

  • Avoid Freeze-Thaw Cycles: Aliquot working solutions to maintain stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Oryzomys palustris (Marsh rice rat)
Target Names
Target Protein Sequence
MNMLLIMLTNIVLSSLLISVAFWLPQPNSYVLKASPYECGFDPMSSACLPFSMKFFLVGI TFLLFDLEIALLLPIPWAMQYTDTHLTMAASFILVSILTLGLAYEWLNKGLEWTE
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This subunit is crucial for the catalytic activity of Complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its function in mitochondrial biology?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is an essential subunit of mitochondrial complex I, which plays a crucial role in the electron transport chain and oxidative phosphorylation. This protein is encoded by mitochondrial DNA and is involved in the active/deactive state transition of complex I. Specifically, MT-ND3 contains a conserved loop region that is critical for regulating complex I activity through conformational changes . This regulatory mechanism is particularly important during ischemia-reperfusion events, where MT-ND3's neighboring residue C39 undergoes S-nitrosation as a protective mechanism . Functional studies have demonstrated that mutations in MT-ND3 can significantly impair complex I assembly, decrease its enzymatic activity, and reduce ATP synthesis, highlighting its essential role in mitochondrial energy production .

What expression systems are available for producing recombinant MT-ND3?

Recombinant MT-ND3 can be produced using multiple expression systems, each with distinct advantages depending on research requirements:

Expression SystemAdvantagesConsiderationsApplications
E. coliHigh yield, cost-effective, rapid expressionMay lack post-translational modifications, potential folding issuesStructural studies, antibody production
YeastEukaryotic processing, moderate yieldLonger production time, more complex mediaFunctional studies requiring some PTMs
BaculovirusProper folding, post-translational modificationsHigher cost, technical complexityStudies requiring authentic protein structure
Mammalian cellsNative-like processing and modificationsLower yield, highest costInteraction studies, functional assays

For Oryzomys palustris MT-ND3, all these systems have been successfully employed as indicated in production catalogs . The choice should be guided by specific experimental needs, with E. coli being suitable for basic structural studies and mammalian systems preferred for functional characterization requiring native conformation.

How can I verify the purity and integrity of recombinant MT-ND3 protein?

Verification of recombinant MT-ND3 purity and integrity requires a multi-technique approach. SDS-PAGE analysis is the primary method, with commercial preparations typically showing >85-90% purity . For more sensitive applications, Western blotting using anti-MT-ND3 or anti-tag antibodies provides specificity confirmation. Mass spectrometry is recommended for precise molecular weight verification and detection of any post-translational modifications or degradation products.

For functional integrity assessment, researchers should consider:

  • Complex I assembly assays using blue native PAGE

  • NADH:ubiquinone oxidoreductase activity measurements

  • Circular dichroism for secondary structure verification

  • Limited proteolysis to confirm proper folding

Quality control data should show single bands on SDS-PAGE with expected molecular weight (~13 kDa plus any tags), and activity assays should demonstrate functional integration into complex I when reconstituted into appropriate membrane systems.

What are the optimal storage and handling conditions for recombinant MT-ND3?

Recombinant MT-ND3 requires careful handling to maintain stability and functionality. Lyophilized powder preparations should be briefly centrifuged before opening to collect all material at the bottom of the vial . Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

For long-term storage:

  • Add glycerol to a final concentration of 5-50% (50% is standard for commercial preparations)

  • Aliquot in small volumes to avoid repeated freeze-thaw cycles

  • Store at -20°C or preferably -80°C

  • For working solutions, store at 4°C for up to one week

The protein is typically provided in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability . Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided, as membrane proteins are particularly susceptible to denaturation during this process.

How can I incorporate recombinant MT-ND3 into functional mitochondrial complex I studies?

Incorporating recombinant MT-ND3 into functional complex I studies requires methodological precision due to its hydrophobic nature and complex assembly requirements:

  • Membrane Reconstitution Approach:

    • Solubilize purified MT-ND3 in mild detergents (DDM, digitonin)

    • Prepare mitochondrial membrane fractions (preferably depleted of endogenous complex I)

    • Mix solubilized MT-ND3 with membrane fractions under controlled detergent concentrations

    • Remove detergent gradually using Bio-Beads or dialysis

    • Verify incorporation using antibody detection and activity assays

  • In vitro Assembly Method:

    • Combine recombinant MT-ND3 with other purified complex I subunits

    • Add specific phospholipids and assembly factors

    • Monitor assembly using blue native PAGE

    • Assess function through NADH:ubiquinone oxidoreductase activity

  • Complementation Studies:

    • Introduce recombinant MT-ND3 into cells with defective endogenous MT-ND3

    • Use mitochondrial targeting sequences for proper localization

    • Evaluate complex I assembly and function using respirometry

    • Assess ATP production levels before and after complementation

Recent research has demonstrated that codon-optimized nuclear expression of MT-ND3 with appropriate mitochondrial targeting sequences can partially restore complex I function in cells with MT-ND3 mutations, suggesting allotopic expression as a viable approach for functional studies .

What controls are essential when using recombinant MT-ND3 in experimental systems?

Robust experimental design with recombinant MT-ND3 requires comprehensive controls:

Essential Negative Controls:

  • Heat-inactivated MT-ND3 (protein boiled for 15 minutes)

  • Catalytically inactive mutant versions (e.g., equivalent to E1347A in DddA experiments)

  • Empty vector or irrelevant protein expressed in the same system

  • Mock reconstitution without MT-ND3

Essential Positive Controls:

  • Wild-type MT-ND3 (when studying mutant versions)

  • Commercially validated complex I preparations

  • Cells with confirmed normal MT-ND3 expression and function

Specificity Controls:

  • Antibody validation using known positive and negative samples

  • Demonstration of tag-specific binding for tagged recombinant proteins

  • Competitive inhibition using excess untagged protein

Technical Controls:

  • Sample processing controls (for each experimental condition)

  • Carrier protein controls when using very dilute solutions

  • Time course studies to establish stability during experimental duration

For mitochondrial localization experiments, colocalization with established mitochondrial markers (e.g., MitoTracker dyes) is essential to confirm proper targeting of recombinant protein.

How can recombinant MT-ND3 be used to study mitochondrial disease mechanisms?

Recombinant MT-ND3 serves as a powerful tool for investigating mitochondrial disease mechanisms, particularly those involving complex I dysfunction:

  • Disease-Associated Variant Modeling:

    • Create recombinant MT-ND3 proteins containing specific pathogenic mutations (e.g., m.10191T>C, m.10197G>C)

    • Compare biochemical properties, stability, and assembly characteristics with wild-type protein

    • Assess effects on complex I function using in vitro activity assays

    • Determine structural changes using biophysical techniques

  • Rescue Experiments:

    • Introduce wild-type recombinant MT-ND3 into patient-derived cells harboring pathogenic MT-ND3 mutations

    • Quantify recovery of complex I assembly and function

    • Measure improvements in ATP synthesis capacity

    • Assess normalization of reactive oxygen species production

  • Drug Screening Applications:

    • Develop assay systems using recombinant MT-ND3 to screen compounds that might stabilize mutant proteins

    • Identify molecules that enhance residual complex I activity

    • Test compounds that promote proper assembly despite MT-ND3 mutations

Recent research has demonstrated that allotopic expression of codon-optimized MT-ND3 can partially restore complex I deficiency in patients with m.10197G>C and m.10191T>C variants, indicating the therapeutic potential of this approach . These studies reveal that recombinant MT-ND3, when properly delivered to mitochondria, can supplement defective native protein and improve energy production in disease models.

What strategies exist for mitochondrial delivery of recombinant MT-ND3 in therapeutic applications?

Delivering recombinant MT-ND3 to mitochondria for therapeutic purposes represents a significant challenge that researchers are addressing through several innovative approaches:

  • Allotopic Expression Strategy:

    • Nuclear encoding of mitochondrial genes with codon optimization

    • Addition of mitochondrial targeting sequences

    • Expression in cytoplasmic ribosomes followed by import into mitochondria

    • This approach has shown partial restoration of protein levels, complex I function, and ATP production in patient cells with MT-ND3 mutations

  • Viral Vector-Based Delivery:

    • AAV (adeno-associated viral) vectors optimized for mitochondrial targeting

    • Design of specialized promoters for expression in target tissues

    • Long-term expression capabilities for sustained therapeutic effect

    • In vivo mtDNA base editing has been demonstrated using AAV delivery systems

  • Mitochondria-Targeted Nanoparticle Systems:

    • Development of lipid-based nanocarriers with mitochondrial targeting moieties

    • Encapsulation of recombinant MT-ND3 with protective elements

    • Surface modification with mitochondrial targeting peptides

    • Controlled release mechanisms to optimize protein delivery

  • Base Editing Technologies:

    • DdCBE (DddA-derived cytosine base editors) for precise mitochondrial DNA editing

    • Targeted modification of specific nucleotides in MT-ND3

    • Creation of specific variants (e.g., G40K) for functional studies

    • Demonstrated effectiveness in both cell culture and mouse models

The most promising approaches combine nuclear expression of codon-optimized MT-ND3 with efficient mitochondrial targeting sequences, as this has shown functional rescue potential in patient-derived cells with MT-ND3 mutations .

How can CRISPR-based mitochondrial DNA editing be applied to MT-ND3 research?

CRISPR-based mitochondrial DNA editing represents a frontier in MT-ND3 research, with specialized adaptations required for mitochondrial genome targeting:

  • DdCBE Technology Application:

    • DddA-derived cytosine base editors specifically designed for mitochondrial DNA

    • TALE domains engineered to target specific MT-ND3 sequences

    • Split DddA toxin (G1333 or G1397) components that reconstitute activity only at target sites

    • Cytosine-to-thymine conversions in mtDNA that can create specific amino acid changes

  • Experimental Design Considerations:

    • Selection of appropriate target sites within MT-ND3 (e.g., targeting m.9576G and m.9577G)

    • Design of complementary TALE domains binding mtDNA light and heavy strands

    • Testing different DddA toxin split configurations for optimal editing efficiency

    • Analysis of editing outcomes using NGS to quantify mutation heteroplasmy levels

  • Mutation Engineering Strategy:

    • Creation of specific amino acid substitutions (e.g., G40K, G40E)

    • Introduction of premature stop codons for functional studies

    • Engineering mutations that affect protein-protein interactions within complex I

    • Targeting conserved domains like the ND3 loop involved in active/deactive state transitions

  • Delivery Systems:

    • AAV vectors for in vivo delivery of mitochondrial base editors

    • Tissue-specific promoters for targeted expression

    • Split-vector approaches to accommodate packaging size limitations

    • Optimization of vector dose and expression duration

Why might recombinant MT-ND3 show reduced activity compared to native protein?

Recombinant MT-ND3 often exhibits reduced activity compared to native protein due to several technical challenges:

  • Conformational Differences:

    • Expression in heterologous systems may lead to improper folding

    • Absence of mitochondrial-specific chaperones during synthesis

    • Potential differences in lipid environment affecting conformation

    • Post-translational modifications may differ from native protein

  • Protein Stability Issues:

    • Hydrophobic nature makes MT-ND3 prone to aggregation

    • Detergent solubilization may partially denature the protein

    • Storage conditions may not preserve native-like structure

    • Freeze-thaw cycles can significantly reduce functional activity

  • Assembly Challenges:

    • MT-ND3 functions as part of a multi-subunit complex

    • In vitro reconstitution may not recapitulate natural assembly process

    • Stoichiometric imbalances with other complex I subunits

    • Absence of assembly factors present in mitochondria

Methodological approaches to address these issues include:

  • Comparing multiple expression systems to identify optimal conditions

  • Using mild detergents at minimal concentrations

  • Reconstituting in lipid nanodisc systems that mimic mitochondrial membranes

  • Including small stabilizing molecules during purification

  • Employing rapid activity assays immediately after reconstitution

Researchers have found that yeast and mammalian expression systems may produce more functionally active MT-ND3 compared to bacterial systems, though at lower yields . Addressing these challenges is essential for accurate functional characterization of MT-ND3 variants.

How can heteroplasmy in MT-ND3 mutations be accurately quantified in research samples?

Accurate quantification of heteroplasmy (the mixture of wild-type and mutant mtDNA) in MT-ND3 research requires specialized methodological approaches:

  • Next-Generation Sequencing (NGS) Methods:

    • Deep sequencing of PCR-amplified MT-ND3 regions

    • Minimum coverage of 1000-10000x recommended for detecting low-level heteroplasmy

    • Bioinformatic analysis with specific pipelines designed for heteroplasmy detection

    • Implementation of error-correction algorithms to distinguish true variants from sequencing errors

    • Research using NGS has successfully quantified editing efficiencies for MT-ND3 mutations (e.g., G40K ~83%, G40E ~14%, G40* ~3%)

  • Digital Droplet PCR (ddPCR):

    • Development of mutation-specific and wild-type specific probes

    • Partitioning of DNA into thousands of droplets

    • Absolute quantification of mutant versus wild-type molecules

    • Highly sensitive detection of heteroplasmy levels as low as 0.1%

  • Pyrosequencing:

    • Quantitative sequencing method with real-time monitoring

    • Direct proportion between signal intensity and nucleotide incorporation

    • Efficient for known mutations with medium throughput

    • Typically detects heteroplasmy levels down to ~3-5%

  • Restriction Fragment Length Polymorphism (RFLP):

    • Design of restriction enzymes that differentially cut mutant/wild-type sequences

    • Quantification by densitometry after gel electrophoresis

    • Generally less sensitive (detection limit ~5-10% heteroplasmy)

    • Useful for quick screening of known mutations

  • Single-cell Approaches:

    • Isolation of individual cells using laser capture or FACS

    • Amplification of mtDNA from single cells

    • Analysis of mutation distribution at cellular level

    • Reveals tissue mosaicism patterns important for phenotype correlation

For base editing experiments targeting MT-ND3, NGS has been the gold standard method, allowing precise quantification of editing outcomes and detection of potential off-target effects across the mitochondrial genome .

What factors affect the efficiency of mitochondrial import for recombinant MT-ND3?

Mitochondrial import efficiency of recombinant MT-ND3 is influenced by multiple factors that researchers must carefully optimize:

  • Mitochondrial Targeting Sequence (MTS) Design:

    • Length of the targeting sequence (typically 20-60 amino acids)

    • Amphipathic α-helical structure with positive charges

    • Cleavage site recognition by mitochondrial processing peptidases

    • Position relative to the MT-ND3 protein sequence

    • Custom MTS design based on well-characterized mitochondrial proteins improves import efficiency

  • Codon Optimization Parameters:

    • Adaptation to nuclear genetic code (differs from mitochondrial code)

    • Optimization for cytosolic translation efficiency

    • GC content adjustment for mRNA stability

    • Elimination of cryptic splice sites

    • Proper codon optimization has been shown to significantly improve expression and subsequent mitochondrial import of MT-ND3

  • Protein Folding Considerations:

    • Prevention of premature folding that may inhibit import

    • Balance between stability in cytosol and import competence

    • Potential requirement for cytosolic chaperones

    • Hydrophobic segments may require special handling

  • Delivery Vehicle Selection:

    • Plasmid-based versus viral vector expression

    • Lipid-based transfection efficiency for different cell types

    • Stable versus transient expression systems

    • AAV serotype selection for tissue-specific targeting in vivo

  • Import Machinery Status:

    • Mitochondrial membrane potential requirements

    • TOM/TIM complex functionality in target cells

    • ATP availability for import process

    • Pre-existing mitochondrial stress may reduce import efficiency

Research has demonstrated that nuclear expression of codon-optimized MT-ND3 with appropriate targeting sequences can achieve sufficient mitochondrial import to partially rescue complex I deficiency in patient cells with MT-ND3 mutations . This allotopic expression approach represents a promising strategy for both research and potential therapeutic applications.

How might structural studies of MT-ND3 inform therapeutic approaches for mitochondrial diseases?

Structural characterization of MT-ND3 offers significant potential for advancing therapeutic strategies for mitochondrial diseases:

  • Structure-Function Relationship Insights:

    • High-resolution structures of MT-ND3 within complex I reveal critical interactions

    • Identification of the conserved ND3 loop involved in active/deactive state transitions

    • Mapping of disease-causing mutations onto structural models

    • Understanding of how G40K mutations might lock complex I in active confirmation

    • Correlation between structural perturbations and biochemical defects

  • Therapeutic Target Identification:

    • Identification of allosteric sites that could stabilize mutant MT-ND3

    • Characterization of protein-protein interaction surfaces amenable to intervention

    • Discovery of pockets that could accommodate small molecule stabilizers

    • Understanding of how S-nitrosation of C39 provides protection against ischemia-reperfusion injury

  • Rational Design Applications:

    • Structure-guided engineering of MT-ND3 variants with enhanced stability

    • Design of compensatory mutations that restore function

    • Development of peptides that mimic critical MT-ND3 functional domains

    • Creation of modified targeting sequences optimized for specific MT-ND3 variants

  • Precision Medicine Approaches:

    • Patient-specific structural modeling of MT-ND3 variants

    • Prediction of functional consequences based on structural perturbations

    • Personalized therapy selection based on structural impact classification

    • Virtual screening of compound libraries against specific mutant structures

Recent structural insights into the role of MT-ND3 in complex I have revealed that mutations in the conserved loop region (including G40K) may affect the active/deactive transition mechanism . This understanding provides a framework for developing targeted interventions that could modulate complex I activity in disease states.

What are the emerging technologies for studying MT-ND3 interactions within the mitochondrial complex I?

Cutting-edge technologies are revolutionizing our ability to study MT-ND3 interactions within complex I:

  • Cryo-Electron Microscopy Advances:

    • Single-particle analysis at near-atomic resolution

    • Time-resolved cryo-EM capturing different conformational states

    • Visualization of complex I in different functional states (active/deactive)

    • Direct observation of MT-ND3 structural changes during catalytic cycle

  • Protein-Protein Interaction Mapping:

    • Proximity labeling techniques (BioID, APEX) adapted for mitochondrial environment

    • Hydrogen-deuterium exchange mass spectrometry for dynamic interaction mapping

    • Cross-linking mass spectrometry to capture transient interactions

    • Single-molecule FRET to monitor conformational changes in real-time

  • Functional Reconstitution Systems:

    • Nanodiscs with controlled lipid composition mimicking mitochondrial membrane

    • Proteoliposomes with co-reconstituted respiratory chain components

    • Microfluidic systems for studying complex I function in confined geometries

    • Cell-free expression systems coupled with immediate functional assessment

  • In vivo Imaging Approaches:

    • Split fluorescent protein complementation adapted for mitochondrial proteins

    • FRET/FLIM imaging of complex I assembly in living cells

    • Super-resolution microscopy of complex I distribution and dynamics

    • Correlative light and electron microscopy for structure-function studies

  • Computational Methods:

    • Molecular dynamics simulations of MT-ND3 within complex I

    • Machine learning approaches to predict interaction networks

    • Quantum mechanics/molecular mechanics modeling of electron transfer

    • Systems biology integration of proteomic, structural, and functional data

These technologies enable researchers to study how MT-ND3 variants affect complex I assembly, stability, and function in unprecedented detail. For example, cryo-EM structures have revealed how the conserved MT-ND3 loop region participates in the conformational changes associated with the active/deactive transition of complex I, providing a structural framework for understanding the impact of disease-causing mutations .

What is the potential of gene therapy approaches targeting MT-ND3 mutations?

Gene therapy targeting MT-ND3 mutations shows promising potential as a therapeutic strategy for mitochondrial diseases:

  • Mitochondrial Base Editing Technology:

    • DdCBE (DddA-derived cytosine base editors) enable precise C-to-T edits in mtDNA

    • TALE-based targeting provides specificity for MT-ND3 sequences

    • AAV delivery systems achieve in vivo editing in post-mitotic tissues

    • Demonstrated efficiency of ~50% editing in mouse heart tissue

    • Potential for correcting specific point mutations in MT-ND3

  • Allotopic Expression Strategy:

    • Nuclear expression of codon-optimized MT-ND3 with mitochondrial targeting

    • Partial restoration of complex I deficiency in patient cells

    • Significant improvement in ATP production in MT-ND3 mutation carriers

    • Demonstrated functional rescue of phenotype in cellular models

    • Potential for AAV-based delivery to affected tissues

  • Heteroplasmy Shifting Approaches:

    • Selective elimination of mutant mtDNA using targeted nucleases

    • Mitochondrially-targeted zinc finger nucleases adapted for MT-ND3

    • TALENs designed to specifically cleave mutant sequences

    • Potential for reducing mutant load below pathogenic threshold

  • RNA Therapeutic Possibilities:

    • Transfer RNA supplementation for mitochondrial function

    • Targeting nuclear-encoded regulators of MT-ND3 expression

    • RNA delivery systems optimized for mitochondrial targeting

    • Potential for transient intervention during critical disease periods

  • Combined Therapeutic Strategies:

    • Integration of base editing with allotopic expression approaches

    • Small molecule stabilizers combined with gene therapy

    • Metabolic bypass strategies supporting gene therapy interventions

    • Personalized approaches based on mutation type and heteroplasmy level

Recent research has demonstrated significant progress in both direct mtDNA editing of MT-ND3 using DdCBEs and functional complementation using nuclear-expressed MT-ND3 . These approaches show potential for clinical translation, particularly for Leigh syndrome and mitochondrial complex I deficiency caused by MT-ND3 mutations. The successful rescue of ATP production in patient cells suggests that even partial restoration of MT-ND3 function may provide therapeutic benefit.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.