Recombinant Osgoodomys banderanus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant MT-ND3 is a 13 kDa subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which facilitates electron transfer in oxidative phosphorylation. Key features include:

PropertySpecification
Source OrganismOsgoodomys banderanus (Michoacan deer mouse)
Expression SystemEscherichia coli (E. coli)
TagN-terminal His tag
Protein LengthFull-length (115 amino acids)
Amino Acid SequenceMNMFMALSVNIILSTCLILIAFWLPQLNLYNEKANPYECGFDQSSTARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMYSINTMMLTAFILVSILALGLAYEWVQKGLEWTE
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% Trehalose (pH 8.0) at -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

Production and Quality Control

Produced via recombinant DNA technology in E. coli, the protein undergoes rigorous validation:

  • Expression: Codon-optimized gene (UniProt ID: O21601) cloned into bacterial vectors .

  • Purification: Affinity chromatography using His-tag followed by lyophilization .

  • Applications:

    • SDS-PAGE analysis of Complex I assembly .

    • Functional studies of mitochondrial disorders (e.g., MELAS, Leigh syndrome) .

Pathogenic Mutations

The ND3 subunit is linked to mitochondrial diseases due to its role in electron transport:

  • 10197G>A Mutation: Causes Leigh syndrome and dystonia by disrupting hydrophobic interactions in the transmembrane domain .

  • Cancer Associations: Polymorphisms (e.g., rs2853826) correlate with increased ROS production and gastric cancer risk .

Therapeutic Insights

  • Disease Modeling: Recombinant MT-ND3 enables in vitro studies of pathogenic variants (e.g., A47T) and drug screening .

  • Biomarker Potential: Altered expression levels are observed in neurodegenerative and metabolic disorders .

Limitations and Best Practices

  • Stability Issues: Avoid repeated freeze-thaw cycles; aliquot upon receipt .

  • Species Specificity: While functional in human cell models, structural differences from human MT-ND3 (UniProt: P03897) may limit translational relevance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Osgoodomys banderanus (Michoacan deer mouse) (Peromyscus banderanus)
Target Names
Target Protein Sequence
MNMFMALSVNIILSTCLILIAFWLPQLNLYNEKANPYECGFDQSSTARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQMYSINTMMLTAFILVSILALGLAYEWVQKGLEWTE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This protein is crucial for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of MT-ND3 in mitochondrial respiration?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase, commonly known as Complex I. This complex is fundamental to cellular respiration, playing a crucial role in the electron transfer process from NADH to the respiratory chain. Within the complex, MT-ND3 is believed to be part of the minimal assembly required for catalysis. The protein participates in a series of redox reactions where the immediate electron acceptor is believed to be ubiquinone .

The protein's role in energy production makes it essential for cellular metabolism. In functional terms, Complex I catalyzes the first step in the electron transport chain of oxidative phosphorylation, pumping protons across the inner mitochondrial membrane to generate the electrochemical gradient necessary for ATP synthesis. Disruptions in MT-ND3 function can significantly impact energy production, potentially leading to mitochondrial diseases such as Leigh syndrome or mitochondrial complex I deficiency .

How conserved is the MT-ND3 gene across rodent species?

The MT-ND3 gene displays notable conservation across rodent species, reflecting its fundamental role in mitochondrial function. Comparative analysis of MT-ND3 sequences from various rodents shows regions of high conservation interspersed with variable domains that often reflect evolutionary relationships. The protein's core functional domains typically show the highest conservation, particularly those involved in electron transport and protein-protein interactions within Complex I.

In phylogenetic studies of Osgoodomys banderanus, an endemic rodent species of western Mexico, MT-ND3 has been analyzed alongside other mitochondrial markers (tRNA-Arginine, ND4L, and partial ND4) to establish evolutionary relationships . Similar studies in other rodents like Baiomys taylori (Northern pygmy mouse) have revealed that the MT-ND3 protein consists of 115 amino acids with conserved transmembrane domains essential for its integration into the mitochondrial membrane .

How can MT-ND3 be used in phylogenetic and taxonomic studies?

MT-ND3 sequences serve as valuable molecular markers for phylogenetic and taxonomic investigations, particularly in rodent species like Osgoodomys banderanus. The gene's moderate rate of evolution makes it suitable for resolving relationships at the species and population levels. Research methodologies typically involve:

  • DNA extraction from tissue samples collected across the species' range

  • PCR amplification of the MT-ND3 gene using specific primers

  • Sequencing of amplified products

  • Alignment of sequences and identification of variable sites

  • Phylogenetic analysis using Maximum Likelihood and Bayesian inference methods

In the case of Osgoodomys banderanus, MT-ND3 sequence analysis helped identify three major genetic lineages that did not correspond to the previously recognized subspecies. These clades included western (Nayarit, Jalisco, northern Colima), central (Colima, Michoacán, northern Guerrero), and eastern (central and southern Guerrero) populations . The genetic distances between these clades (5-9%) and the substantial nucleotide substitutions (30-88) among haplogroups provided evidence suggesting the potential existence of three distinct species rather than a single species with subspecies.

What experimental approaches can be used to express recombinant MT-ND3 from Osgoodomys banderanus?

Expressing recombinant MT-ND3 from Osgoodomys banderanus presents several technical challenges due to its hydrophobic nature and mitochondrial origin. Based on successful approaches with similar proteins, researchers can employ the following experimental strategies:

  • Codon optimization: The MT-ND3 gene should undergo codon optimization for the expression system of choice, typically E. coli, yeast, or mammalian cells. This process adjusts codon usage to match the preferred codons of the host organism while maintaining the amino acid sequence, significantly improving expression levels .

  • Expression vector selection: Vectors containing strong inducible promoters (such as T7 or CMV) coupled with appropriate tags (His, GST, or MBP) facilitate both expression and subsequent purification. The His-tag approach has proven effective for MT-ND3 proteins from other species .

  • Expression systems: While E. coli remains the most common system due to its simplicity and cost-effectiveness, the hydrophobic nature of MT-ND3 often necessitates eukaryotic expression systems like yeast, insect cells, or mammalian cells for proper folding and post-translational modifications.

  • Solubilization strategies: Incorporation of solubility-enhancing tags or expression as fusion proteins can improve the solubility of this highly hydrophobic membrane protein. Alternatively, direct expression into inclusion bodies followed by refolding protocols may be employed.

A sample expression protocol, adapted from successful recombinant MT-ND3 production in related species, would include:

StepProcedureParameters
1Gene synthesisCodon-optimized MT-ND3 with flanking restriction sites
2Vector cloningpET28a with N-terminal His-tag
3TransformationBL21(DE3) E. coli strain
4Expression induction0.5 mM IPTG, 18°C, 16-20 hours
5Cell harvestCentrifugation at 5000×g, 4°C
6LysisSonication in buffer with detergents (e.g., 1% DDM)
7PurificationNi-NTA affinity chromatography
8Quality controlSDS-PAGE and Western blot analysis

How can researchers distinguish between normal variants and pathogenic mutations in MT-ND3?

Distinguishing between benign polymorphisms and pathogenic mutations in MT-ND3 requires a multifaceted approach combining computational predictions, functional assays, and comparative genomics:

  • Sequence conservation analysis: Pathogenic mutations typically affect highly conserved residues across species. Multiple sequence alignment of MT-ND3 from various species, including Osgoodomys banderanus and related rodents, can identify conservation patterns. Mutations at highly conserved positions are more likely to be pathogenic.

  • Structural impact prediction: Computational tools can predict how amino acid substitutions might affect protein structure and function. For MT-ND3, particular attention should be paid to residues involved in complex I assembly interfaces or electron transport.

  • Functional assays: The gold standard for assessing pathogenicity involves measuring the functional impact of variants. Methodologies include:

    • Complex I activity assays using spectrophotometric methods

    • ATP synthesis measurements in cell models expressing variant proteins

    • Mitochondrial membrane potential assessments using fluorescent probes

    • Measurement of reactive oxygen species production

  • Population frequency data: Benign polymorphisms tend to appear at higher frequencies in populations, while pathogenic mutations are typically rare. For Osgoodomys banderanus, this would involve sequencing MT-ND3 across multiple populations to establish baseline variation.

Research on human MT-ND3 variants has demonstrated that pathogenic mutations like m.10191T>C and the novel m.10197G>C significantly affect MT-ND3 protein levels, complex I assembly, and ATP synthesis . Similar functional analyses could be adapted for studying Osgoodomys banderanus MT-ND3 variants to determine their pathogenicity.

What role does MT-ND3 play in the evolutionary adaptation of Osgoodomys banderanus?

MT-ND3 may contribute significantly to the evolutionary adaptation of Osgoodomys banderanus across its diverse ecological niches in western Mexico. As a component of the mitochondrial respiratory chain, variations in this gene could influence metabolic efficiency, potentially adapting populations to different environmental conditions.

Phylogeographic studies have revealed three distinct MT-ND3 lineages in O. banderanus separated by geographical barriers including mountain ranges (Transmexican Volcanic Belt and Sierra Madre del Sur) and the Balsas River . These genetic divergences suggest that:

  • Allopatric speciation: Geographical isolation has likely driven genetic differentiation in MT-ND3 and other mitochondrial genes, resulting in distinct evolutionary lineages.

  • Adaptive selection: Different environments may exert selective pressures on mitochondrial function, particularly in response to:

    • Altitude variation affecting oxygen availability

    • Temperature gradients requiring metabolic adaptations

    • Dietary differences influencing energy metabolism requirements

  • Co-evolution with nuclear genes: MT-ND3 functions in complex I alongside nuclear-encoded subunits, necessitating co-evolution between mitochondrial and nuclear genomes to maintain optimal respiratory function.

Research methodologies to investigate adaptive evolution of MT-ND3 would include:

  • Analysis of synonymous vs. non-synonymous substitution rates (dN/dS) to detect signatures of selection

  • Correlation of specific MT-ND3 variants with environmental variables

  • Functional testing of variant proteins to assess metabolic efficiency under different conditions

  • Comparative analysis with other rodent species occupying similar ecological niches

What expression systems are most effective for producing functional recombinant MT-ND3?

The selection of an appropriate expression system is critical for producing functional recombinant MT-ND3. Based on experiences with similar mitochondrial membrane proteins, the following systems offer distinct advantages:

A comparison of expression systems for recombinant MT-ND3 production:

Expression SystemAdvantagesDisadvantagesTypical YieldFunctionality
E. coliHigh yield, simple, economicalInclusion bodies, lacks PTMs10-50 mg/LModerate
YeastGood yield, eukaryotic foldingLonger production time5-20 mg/LGood
Insect cellsProper folding, PTMsComplex, moderate yield2-10 mg/LVery good
Mammalian cellsNative environment, best foldingLow yield, expensive0.5-5 mg/LExcellent

The choice of expression system should be guided by the specific research objectives. For structural studies requiring large quantities, bacterial or yeast systems may be preferable. For functional studies, particularly those investigating disease-associated variants, insect or mammalian systems are recommended despite their lower yields.

How can codon optimization enhance the expression of recombinant MT-ND3?

Codon optimization represents a powerful strategy for improving the expression of mitochondrial proteins like MT-ND3 in heterologous systems. This technique adjusts the codon usage of the target gene to match the preferred codons of the host organism without altering the amino acid sequence. For MT-ND3 from Osgoodomys banderanus, codon optimization offers several specific benefits:

  • Addressing genetic code differences: Mitochondrial genes like MT-ND3 use a slightly different genetic code than nuclear genes. Codon optimization reconciles these differences for expression in conventional systems.

  • Optimizing translation efficiency: By replacing rare codons with more abundant ones in the host organism, ribosomal pausing is minimized, leading to more efficient translation and higher protein yields.

  • Enhancing mRNA stability: Optimization can eliminate nucleotide sequences that form secondary structures or premature termination signals, improving mRNA stability and translation.

Recent research on human MT-ND3 variants demonstrated the effectiveness of codon optimization coupled with mitochondrial targeting sequences for expressing functional mitochondrial proteins . This approach allowed for nuclear expression of the codon-optimized MT-ND3 gene and subsequent import of the protein into mitochondria, successfully rescuing defects in patients with MT-ND3 variants.

A methodological framework for codon optimization includes:

  • Analysis of codon usage bias in the host expression system

  • Adjustment of the MT-ND3 sequence to reflect preferred codons

  • Elimination of cryptic splice sites and other problematic sequence elements

  • Incorporation of appropriate restriction sites for cloning

  • Synthetic gene synthesis of the optimized sequence

For Osgoodomys banderanus MT-ND3, this approach could significantly improve recombinant protein yields across multiple expression systems, facilitating structural and functional studies.

What functional assays can verify the activity of recombinant MT-ND3?

Verifying the functional activity of recombinant MT-ND3 requires specialized assays that assess its integration into Complex I and contribution to electron transport. The following methodological approaches are recommended:

  • Complex I assembly assays:

    • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) to visualize intact Complex I containing recombinant MT-ND3

    • Immunoprecipitation with antibodies against other Complex I subunits to confirm MT-ND3 incorporation

    • Proximity labeling techniques to validate proper protein-protein interactions within the complex

  • Electron transport activity:

    • NADH:ubiquinone oxidoreductase activity assay measuring the rate of NADH oxidation spectrophotometrically

    • Oxygen consumption rate (OCR) measurements using platforms like Seahorse XF Analyzer

    • Artificial electron acceptor assays using ferricyanide or similar compounds

  • Functional complementation:

    • Rescue of Complex I deficiency in cell lines with MT-ND3 mutations or deletions

    • Restoration of mitochondrial membrane potential measured with fluorescent probes (TMRM, JC-1)

    • Recovery of ATP synthesis measured using luciferase-based assays

  • Structural integrity:

    • Limited proteolysis to assess proper folding of recombinant MT-ND3

    • Thermal shift assays to evaluate protein stability

    • Circular dichroism spectroscopy to analyze secondary structure content

A recent study demonstrated the effectiveness of functional rescue approaches using codon-optimized MT-ND3 in patients with pathogenic variants. The recombinant protein successfully restored complex I assembly, improved its activity, and significantly enhanced ATP production . Similar methodology could be adapted for testing recombinant Osgoodomys banderanus MT-ND3 functionality.

How does MT-ND3 sequence variation correlate with geographical distribution of Osgoodomys banderanus?

MT-ND3 sequence variation in Osgoodomys banderanus shows strong correlation with geographical distribution, providing insights into population structure and evolutionary history. Phylogeographic analysis based on mitochondrial sequences, including MT-ND3, has identified three major genetic lineages that correspond to distinct geographical regions in western Mexico .

The genetic differentiation observed in MT-ND3 and other mitochondrial genes appears to be influenced by significant geographical barriers:

  • Western clade: Distributed across Nayarit, Jalisco, and northern Colima

  • Central clade: Found in Colima, Michoacán, and northern Guerrero

  • Eastern clade: Restricted to central and southern Guerrero

These clades show substantial genetic divergence, with intergroup genetic distances ranging from 5-9% and nucleotide substitutions between haplogroups ranging from 30-88, with particularly high differentiation in the southern group . This pattern suggests that geographical features including the Transmexican Volcanic Belt, the Sierra Madre del Sur mountain ranges, and the Balsas River have acted as effective barriers to gene flow.

The methodological approach for investigating this correlation involves:

  • Comprehensive sampling across the species' range

  • Sequencing of MT-ND3 and other mitochondrial markers

  • Phylogenetic analysis using Maximum Likelihood and Bayesian methods

  • Calculation of genetic distances between populations

  • Correlation of genetic patterns with geographical features

This phylogeographic structure revealed by MT-ND3 analysis suggests that what has been considered a single species with subspecies may actually represent three distinct species that require further morphological characterization .

How do MT-ND3 variants in Osgoodomys banderanus compare to those in related rodent species?

Comparative analysis of MT-ND3 variants between Osgoodomys banderanus and related rodent species provides valuable insights into evolutionary relationships and functional constraints on this mitochondrial protein. Although direct comparisons with Baiomys taylori (Northern pygmy mouse) MT-ND3 are not fully detailed in the available literature, we can extrapolate from what is known about both species.

The MT-ND3 protein in Baiomys taylori consists of 115 amino acids, with a sequence that includes multiple transmembrane domains characteristic of this mitochondrial protein . For meaningful comparative analysis between Osgoodomys banderanus and related rodents, researchers would typically:

  • Perform multiple sequence alignment of MT-ND3 protein sequences from various rodent species

  • Identify conserved domains that likely represent functionally critical regions

  • Analyze variable regions that may reflect adaptations to different ecological niches

  • Calculate evolutionary distances to establish phylogenetic relationships

  • Identify selection signatures that might indicate adaptive evolution

A hypothetical comparative table of MT-ND3 conservation across rodent species might look like:

SpeciesSequence Identity with O. banderanusConserved DomainsVariable Regions
Baiomys taylori~85-90% (estimated)Transmembrane domains, NADH binding sitesN-terminal region, intermembrane loops
Peromyscus species~80-85% (estimated)Electron transport domainsSpecies-specific variation in non-functional regions
Mus musculus~75-80% (estimated)Core catalytic regionsPeripheral structural elements
Rattus norvegicus~75-80% (estimated)Ubiquinone interaction sitesSurface-exposed residues

The high genetic distances (5-9%) observed between different Osgoodomys banderanus clades suggest that intraspecies variation in this taxon may approach levels typically seen between distinct species in other rodent groups, supporting the hypothesis that O. banderanus may represent a species complex rather than a single species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.