Recombinant Osmolarity sensor protein EnvZ (envZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
envZ; SF3423; S4340; Sensor histidine kinase EnvZ; Osmolarity sensor protein EnzV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Shigella flexneri
Target Names
envZ
Target Protein Sequence
MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Uniprot No.

Target Background

Function

EnvZ is a membrane-associated protein kinase and a component of the EnvZ/OmpR two-component regulatory system. This system governs osmoregulation, specifically influencing the expression of the ompF and ompC genes. EnvZ phosphorylates OmpR in response to environmental stimuli, and this system plays a significant role in bacterial virulence.

Database Links

KEGG: sfl:SF3423

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is EnvZ and how does it function in bacterial osmosensing?

EnvZ is a transmembrane histidine kinase that functions as the sensor component of the EnvZ/OmpR two-component signaling system. It consists of 450 amino acid residues with two transmembrane helices, a periplasmic structural domain, and a cytoplasmic structural domain .

When stimulated by changes in osmotic pressure, EnvZ senses these changes through its cytoplasmic structural domain, causing autophosphorylation at His-243. It then transfers this phosphate group to OmpR, with the phosphorylated OmpR (OmpR-P) binding to outer membrane protein genes to respond to osmotic stress . EnvZ responds primarily to cytoplasmic signals that arise from changes in the extracellular milieu, and OmpR acts canonically (requiring phosphorylation) to regulate gene expression .

How is the EnvZ/OmpR two-component system structured and what are its primary regulatory targets?

The EnvZ/OmpR system consists of:

  • EnvZ: The membrane-bound sensor histidine kinase

  • OmpR: The cytoplasmic response regulator

This system primarily regulates outer membrane porins OmpC and OmpF in response to osmotic pressure. At high osmolarity, phosphorylated OmpR increases expression of OmpC while repressing OmpF. At low osmolarity, the opposite occurs . Beyond porin regulation, the EnvZ/OmpR system also influences:

  • Motility genes (including flhD and fliC)

  • Biofilm formation genes

  • Stress response systems

  • Other two-component systems

What are the established methods for creating and validating EnvZ deletion mutants?

The most common approach for creating EnvZ deletion mutants involves λ-red recombination techniques:

  • Primer design and amplification:

    • Design primers to amplify upstream and downstream segments of envZ

    • Amplify a resistance cassette (e.g., chloramphenicol) with specialized primers

    • Use overlap PCR to combine these fragments

  • Transformation and selection:

    • Electroporate the PCR product into competent cells containing the pKD46 plasmid

    • Select transformants on appropriate antibiotic media

    • Transform the pCP20 plasmid to remove the resistance cassette

  • Verification methods:

    • PCR verification with primers outside and inside the deletion region

    • DNA sequencing of the deletion junctions

    • qPCR to confirm absence of envZ expression

    • Complementation with wild-type envZ to restore phenotype

Typical electroporation parameters: 200 Ω and 2,500 V using a Gene Pulser or similar device .

How can point mutations be introduced into the EnvZ protein?

Site-directed mutagenesis for EnvZ can be performed using several approaches:

  • CRISPR-Cas9 based approach (CRMAGE):

    • Transform bacteria with a plasmid expressing Cas9 and a guide RNA targeting envZ

    • Co-transform with an oligonucleotide containing the desired mutation

    • Screen colonies by PCR and Sanger sequencing

  • Traditional site-directed mutagenesis:

    • Clone envZ into a suitable vector

    • Perform PCR with primers containing the desired mutation

    • Digest template DNA with DpnI

    • Transform into competent cells

    • Verify by sequencing

Important considerations for EnvZ mutations:

  • The D233N mutation has been shown to confer resistance to antimicrobial peptides

  • Mutations in the HAMP domain (e.g., A193L) can affect signal transduction

  • Different mutations may produce gain-of-function or loss-of-function phenotypes

What approaches are used to express and purify recombinant EnvZ protein domains?

Expression strategies:

  • Full-length EnvZ:

    • Often challenging due to transmembrane domains

    • May require detergents or membrane mimetics (nanodiscs)

  • Cytoplasmic domain (EnvZc):

    • More commonly used for biochemical studies

    • Retains osmosensing capability

  • Fusion protein approaches:

    • Protein S fusion for HAMP domain expression

    • MBP or GST fusion tags to enhance solubility

Purification protocol:

  • Transform expression vector into E. coli (typically BL21 or DH5α)

  • Induce with IPTG (typically 0.1-1.0 mM)

  • Harvest cells and lyse by sonication

  • Perform affinity chromatography based on fusion tag

  • Use proteolytic cleavage to remove tag if necessary

  • Further purify by ion exchange or size exclusion chromatography

Buffer conditions:

  • Typical buffer: 50 mM Tris-HCl, pH 8.0, 100 mM NaCl, 4 mM MgCl₂, 0.1 mM CaCl₂

  • Addition of 1% thiamine HCl may enhance stability

How does EnvZ contribute to bacterial pathogenicity in different species?

EnvZ significantly impacts pathogenicity through multiple mechanisms:

  • In Avian pathogenic E. coli (APEC):

    • Deletion of envZ attenuates APEC pathogenicity in chickens

    • Contributes to resistance against acid, alkali, osmotic, and oxidative stress

    • Affects biofilm formation and bacterial morphology (rdar morphotype)

    • Influences serum resistance and adhesion to host cells

    • Modulates host inflammatory responses (IL-1β, IL6, IL8)

  • Transcriptional changes in pathogenicity genes:

    • RNA-Seq analysis identified 711 differentially expressed genes in APEC envZ mutants

    • These genes are enriched in outer membrane proteins, stress response systems, and TCSs

    • EnvZ influences expression of biofilm formation genes

  • Antimicrobial peptide resistance:

    • The EnvZ D233N mutation confers resistance to antimicrobial peptides like TAT-RasGAP 317-326

    • This is a gain-of-function mutation requiring the OmpR response regulator

    • The mutation affects peptide binding and entry into bacterial cells

What is the relationship between EnvZ/OmpR and other two-component systems in bacterial adaptation?

EnvZ/OmpR interacts with other signaling systems in complex regulatory networks:

  • Integration with OPG (osmoregulated periplasmic glucans) system:

    • Inactivation of EnvZ/OmpR in an OPG-defective mutant restores full synthesis of pectinase

    • This indicates cross-regulation between these osmoregulatory systems

  • Motility regulation interactions:

    • EnvZ/OmpR regulates FlhDC, the master regulator of motility

    • This impacts downstream expression of motility genes like fliC

    • Expression of flhD and fliC decreases 10-fold from low to high osmolarity in wild-type strains

    • Disruption of envZ or ompR leads to decreased flhD expression, though not always statistically significant

  • Mechanistic insights from chimeric proteins:

    • Chimeric proteins combining methanol-sensing domains (MxbD and MxcQ) with EnvZ have been created

    • These chimeric sensor kinases allow integration of different environmental signals

    • Methanol-sensing domains can be fused to EnvZ while maintaining function

    • The aspartate receptor Tar can also be fused with EnvZ (Taz1), demonstrating modularity of these signaling systems

How do structural changes in the HAMP domain affect EnvZ signal transduction?

The HAMP domain plays a crucial role in transmitting signals from periplasmic/transmembrane regions to the cytoplasmic kinase domain:

How should researchers interpret contradictory phenotypes in EnvZ mutants across different bacterial species?

Interpreting contradictory EnvZ mutant phenotypes requires careful consideration of several factors:

  • Species-specific differences:

    • In S. oneidensis, deletion of EnvZ/OmpR shows no noticeable growth differences under normal or stressed conditions

    • In contrast, E. coli shows significant growth slowdown with EnvZ/OmpR deletion

    • This indicates substantial divergence in physiological roles between species

  • Methodological approach to consider:

    • Compare growth parameters (generation time, maximum cell density)

    • Use Phenotype Microarrays (PM) to broadly assess metabolic and stress responses

    • Perform independent validation experiments for key phenotypes

    • Consider genetic background effects that may influence results

  • Distinguishing direct vs. indirect effects:

    • Complete deletion vs. point mutations may produce different phenotypes

    • For example, EnvZ D233N mutation confers peptide resistance while complete deletion of envZ does not

    • This indicates the D233N represents a gain-of-function mutation

    • When analyzing phenotypes, consider whether changes are primary or secondary effects

What methodologies are recommended for analyzing transcriptomic data from EnvZ/OmpR mutant studies?

Transcriptomic analysis of EnvZ/OmpR systems requires robust analytical approaches:

  • RNA extraction and quality control:

    • Use cDNA synthesis with random hexamer primers

    • Design specific primers with specialized software (e.g., OLIGO v5.0)

    • Ensure proper normalization with reference genes (ipxC has been validated)

  • Differential expression analysis workflow:

    • Compare wild-type, single mutants (envZ or ompR), and double mutants

    • Group differentially expressed genes (DEGs) by functional categories

    • Look for enrichment in membrane proteins, stress response systems, and TCSs

    • Validate key findings with RT-qPCR

  • Common pitfalls and solutions:

    • Environmental conditions significantly impact EnvZ/OmpR regulated genes

    • Test multiple osmolarities (170, 330, 500, 700 mOsM are standard points)

    • Consider growth phase effects (exponential vs. stationary)

    • Use statistical analysis (ANOVA) to determine significance of differential expression

How can researchers address and overcome challenges related to "academic envy" in competitive research fields?

Academic envy is common in competitive research environments like molecular biology and bacterial genetics. Researchers working on popular systems like EnvZ/OmpR may experience this, particularly when others publish significant findings. Strategies to address this include:

  • Recognizing normal feelings:

    • Understand that academic envy is a normal response in competitive environments

    • Being aware of these feelings is the first step to addressing them

  • Practical approaches for researchers:

    • "Keep your eyes in your own lane" - focus on your unique research contributions

    • Remind yourself that success is not an expendable resource

    • No one's research career is perfect - everyone faces challenges

    • Collaborate rather than compete when possible

  • Healthy scientific perspectives:

    • Science is not a zero-sum game - others' successes don't diminish your work

    • Value being part of collaborative research rather than focusing solely on authorship position

    • Focus on the discovery aspect of research rather than metrics and journal prestige

    • Consider seeking professional support if academic envy significantly impacts wellbeing

What are the recommended approaches for designing chimeric EnvZ proteins for novel sensing applications?

Creating functional chimeric EnvZ proteins requires careful design considerations:

  • Domain junction selection:

    • Use molecular modeling to predict optimal fusion sites

    • The EnvZ HAMP domain is a common fusion point (around residues 180-235)

    • Structural analysis shows four-helix bundle subdomains are sensitive to osmolytes while ATP binding subdomains are sensitive to nucleotide binding

  • Successful chimeric examples:

    • MxbDZ and MxcQZ: Integration of methanol-sensing domains with EnvZ

    • Taz1: Fusion of aspartate receptor (Tar) N-terminal segments with EnvZ cytoplasmic domain

    • These chimeras demonstrate the modular nature of bacterial signaling proteins

  • Experimental validation methods:

    • Monitor phosphorylation activity using radiolabeled ATP

    • Measure promoter activation with reporter genes (e.g., ompC-lacZ)

    • Characterize stimulus response using dose-dependent activity assays

    • Perform molecular dynamics simulations to predict conformational changes

How can researchers quantitatively assess EnvZ/OmpR system robustness in different genetic backgrounds?

Quantitative assessment of EnvZ/OmpR system robustness requires systematic approaches:

  • Experimental measurement strategies:

    • Express EnvZ at different concentrations and measure OmpR phosphorylation

    • Use reporter systems like ompC-lacZ to quantify transcriptional output

    • Perform super-resolution imaging for molecular counting of EnvZ molecules

    • Compare responses across various osmotic conditions

  • Key observations about system robustness:

    • Earlier claims suggested OmpR~P levels were independent of EnvZ concentration

    • More recent findings contradict this, showing ompC-lacZ activity increases at elevated EnvZc concentrations

    • At very high levels, EnvZ overexpression can inhibit ompC transcription

    • These findings suggest the EnvZ/OmpR system is not completely robust

  • Data analysis framework:

    • Plot dose-response curves of output vs. EnvZ levels

    • Calculate sensitivity parameters (how output changes with EnvZ concentration)

    • Compare results across different genetic backgrounds and environmental conditions

    • Create mathematical models to explain observed behaviors

EnvZ LevelSystem BehaviorReference
NormalStandard osmotic response
Moderately elevatedIncreased ompC-lacZ activity
Highly elevatedInhibition of ompC transcription

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.