Recombinant Ostreid herpesvirus 1 Putative transmembrane protein ORF111 (ORF110)

Shipped with Ice Packs
In Stock

Description

Genetic Context in OsHV-1

ORF110/ORF111 is part of the OsHV-1 genome, which exhibits significant variability across strains. Comparative genomic studies reveal:

Key Genomic Features

  • OsHV-1-SB variant: Contains ORF110 intact, while other ORFs (e.g., ORF4, ORF50) are deleted .

  • Phylogenetic relationship: Closely related to AVNV (97.3% identity) and OsHV-1 reference type (95.2% identity) .

  • Genomic rearrangements: ORF110 remains conserved despite large deletions (>1 kb) in other regions .

Table: ORF110 Conservation Across OsHV-1 Variants

VariantGenome Size (bp)ORF110 StatusNotable Deletions in Other ORFs
OsHV-1-SB 199,354IntactORF4, ORF5, ORF50, ORF115, ORF117
OsHV-1 reference 207,439IntactN/A
AVNV 200,312IntactORF122, ORF123

Recombinant Production

ParameterSpecification
Expression SystemE. coli
TagN-terminal His tag
Purification MethodAffinity chromatography
Reconstitution0.1–1.0 mg/mL in deionized water with 5–50% glycerol

Research Applications

  • Antibody development: Used to generate antibodies for OsHV-1 detection .

  • Structural studies: Analysis of viral membrane protein architecture .

  • Pathogenesis models: Testing interactions with host proteins like cytoskeletal components .

Limitations and Future Directions

  • Functional data gap: No direct evidence of ORF110’s role in viral entry or replication .

  • Host specificity: Interactions with molluskan receptors remain uncharacterized .

  • Therapeutic potential: Untested in vaccine development despite conservation across strains .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer composition, storage temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
ORF110; Putative transmembrane protein ORF111
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)
Target Names
ORF110
Target Protein Sequence
MIGPIVVLHLICAVGFSIFMLQYYNILYDKPACNHMGGCEMQDIYKVTENSTEDENGTLT TTTIKPVKTPACPVKECRGDEFCCKLCSEVKGNDYSERPIHMESTLYIHNPAIITIAIVG VVIGVFIIVCIANICRMKSGKRGTTFVRFLIGITLFLLFLTLAGSVAFIVISIISDFDYY KDCHAKLTLNISWGFVCGILAISYSTSILPSFTRIMRAEQLKRDALDIPDHDESTQMLIK ADRLKHEPIEKPGLFSTIARYLLTLCLLWWPAITIYFIGVGQGRWLPIV
Uniprot No.

Target Background

Database Links

KEGG: vg:2948256

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the Ostreid herpesvirus 1 putative transmembrane protein ORF111 (ORF110)?

Ostreid herpesvirus 1 putative transmembrane protein ORF111 (ORF110) is a viral protein encoded by the OsHV-1 genome, a major pathogen affecting Pacific oysters (Crassostrea or Magallana gigas). The protein consists of 289 amino acids and contains predicted transmembrane domains suggesting its potential localization in cellular membranes during viral infection. The full amino acid sequence of this protein is MIGPIVVLHLICAVGFSIFMLQYYNILYDKPACNHMGGCEMQDIYKVTENSTEDENGTLTTTTIKPVKTPACPVKECRGDEFCCKLCSEVKGNDYSERPIHMESTLYIHNPAIITIAIVGVVIGVFIIVCIANICRMKSGKRGTTFVRFLIGITLFLLFLTLAGSVAFIVISIISDFDYYKDCHAKLTLNISWGFVCGILAISYSTSILPSFTRIMRAEQLKRDALDIPDHDESTQMLIKADRLKHEPIEKPGLFSTIARYLLTLCLLWWPAITIYFIGVGQGRWLPIV . Current research suggests this protein may be involved in viral entry, membrane fusion, or immune evasion mechanisms, similar to other herpesvirus transmembrane proteins.

What expression systems are commonly used for producing recombinant ORF111 (ORF110)?

The most common expression system for producing recombinant ORF111 (ORF110) is Escherichia coli. Commercially available recombinant versions typically utilize E. coli expression systems with N-terminal His tags to facilitate purification . While E. coli offers advantages in terms of scalability and cost-effectiveness, researchers should consider that this prokaryotic expression system may not reproduce all post-translational modifications present in the native viral protein. Alternative expression systems such as insect cells (baculovirus expression vector system) or mammalian cells might provide recombinant proteins with more native-like modifications, although these approaches are less commonly reported in the literature for this specific protein.

What are the optimal storage and reconstitution conditions for recombinant ORF111 (ORF110)?

Recombinant ORF111 (ORF110) protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt. For long-term storage, aliquoting is necessary to avoid repeated freeze-thaw cycles, which can compromise protein integrity. Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom. The optimal reconstitution procedure involves dissolving the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% (optimally 50%) is recommended before aliquoting for long-term storage at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein stability and activity.

How can researchers establish an in vitro model system to study ORF111 (ORF110) function?

Researchers can establish an in vitro model system using Pacific oyster tissue explants maintained in controlled laboratory conditions. This approach has been validated for studying OsHV-1 replication without the confounding factors present in whole animal studies . To implement this method, researchers should:

  • Obtain Pacific oysters from different sources (preferably with known differential susceptibility to OsHV-1)

  • Harvest tissue explants (mantle, muscle, and gill tissues have all demonstrated successful viral replication)

  • Maintain explants in appropriate culture media under axenic conditions

  • Challenge the explants with OsHV-1 containing ORF111 (ORF110)

  • Monitor viral replication using quantitative PCR, histology, and electron microscopy

This tissue explant model offers several advantages: it allows for tightly controlled experimental conditions, removes biotic and abiotic confounding factors, simplifies biosecurity requirements, and eliminates the need for complex aquarium systems. The model also maintains the genetic determinants of host susceptibility, making it particularly valuable for studies focused on host-pathogen interactions involving ORF111 (ORF110).

What analytical techniques are most effective for studying ORF111 (ORF110) interactions with host cells?

A multi-faceted analytical approach is most effective for studying ORF111 (ORF110) interactions with host cells:

TechniqueApplicationAdvantages
Quantitative PCRViral load quantificationHigh sensitivity, quantitative assessment of viral replication
HistopathologyTissue-level pathologyVisualization of infection-associated changes
Transmission Electron MicroscopyUltrastructural analysisDirect visualization of virus particles and cellular localization
ImmunofluorescenceProtein localizationDetermination of cellular distribution of ORF111
Co-immunoprecipitationProtein-protein interactionsIdentification of host binding partners
RNA-SeqTranscriptional responsesComprehensive analysis of host gene expression changes
CRISPR-Cas9 mutagenesisFunctional validationAssessment of specific protein domains

The combination of these techniques allows researchers to characterize both the localization and function of ORF111 (ORF110) during infection, providing insights into its role in viral pathogenesis and potential interactions with host immune pathways.

How might ORF111 (ORF110) contribute to OsHV-1 immune evasion mechanisms?

ORF111 (ORF110), as a putative transmembrane protein, may play crucial roles in OsHV-1 immune evasion similar to other herpesvirus transmembrane proteins. Herpesviruses typically employ multiple strategies to evade host immune responses during both lytic replication and latency . While specific mechanisms for ORF111 have not been fully characterized, its predicted membrane localization suggests potential involvement in:

  • Interfering with pattern recognition receptors (PRRs) that detect viral nucleic acids

  • Disrupting interferon signaling pathways, which are critical for antiviral responses

  • Modulating cell surface expression of immune recognition molecules

  • Altering host cell membrane properties to facilitate viral spread while evading immune detection

Research into ORF111's potential role in immune evasion would benefit from comparative analyses with better-characterized herpesvirus proteins such as KSHV's ORF45, which inhibits phosphorylation and nuclear translocation of IRF-7, or the vIRF family proteins that interfere with interferon regulatory factors . Determining whether ORF111 targets similar pathways would provide valuable insights into OsHV-1 pathogenesis mechanisms.

What experimental approaches can distinguish between the functions of ORF111 and other OsHV-1 proteins?

To distinguish the specific functions of ORF111 from other OsHV-1 proteins, researchers should employ a combination of complementary approaches:

These approaches, especially when used in conjunction with the tissue explant model system, would help delineate the specific contributions of ORF111 to viral replication and host interactions .

How can researchers leverage genomic and proteomic approaches to understand ORF111 (ORF110) evolution?

Understanding ORF111 (ORF110) evolution requires integrated genomic and proteomic approaches:

  • Comparative genomics: Analyzing ORF111 sequences across different OsHV-1 variants and related molluscan herpesviruses to identify conserved domains and variant-specific adaptations. This approach can highlight regions under selection pressure, suggesting functional importance.

  • Structural proteomics: Predicting and experimentally determining the three-dimensional structure of ORF111 to identify functional domains and potential interaction surfaces. Comparing these structures with homologous proteins from other herpesviruses can reveal evolutionary relationships.

  • Functional proteomics: Using techniques such as BioID or proximity labeling to identify the ORF111 interactome in different host species or tissues. Differences in interaction partners may indicate functional adaptations to specific hosts.

  • Evolutionary rate analysis: Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) in ORF111 across viral strains to identify regions under positive or purifying selection.

  • Host-pathogen co-evolution studies: Correlating ORF111 sequence variations with changes in host immune genes to identify potential co-evolutionary relationships.

These approaches can reveal how ORF111 has evolved to optimize virus-host interactions in different oyster populations and potentially inform strategies for breeding resistance to OsHV-1 infection.

What are common pitfalls when working with recombinant ORF111 (ORF110) and how can they be addressed?

When working with recombinant ORF111 (ORF110), researchers commonly encounter several challenges:

ChallengePotential CausesSolutions
Low protein solubilityHydrophobic transmembrane domainsUse appropriate detergents (e.g., DDM, CHAPS); optimize buffer conditions; consider fusion tags to enhance solubility
Protein aggregationImproper folding; concentration too highReduce protein concentration; add stabilizing agents (glycerol, trehalose); optimize buffer pH and ionic strength
Loss of activity upon storageFreeze-thaw damage; proteolytic degradationAdd protease inhibitors; store in single-use aliquots with glycerol; avoid repeated freeze-thaw cycles
Poor antibody recognitionEpitope masking; non-specific bindingUse multiple antibodies targeting different epitopes; optimize blocking conditions; validate antibody specificity
Inconsistent experimental resultsBatch-to-batch variability; experimental conditionsInclude appropriate controls; standardize protocols; maintain consistent source material

Additionally, when conducting functional studies, the absence of a continuous cell line from Pacific oysters presents a significant challenge. The tissue explant model offers a viable alternative but requires careful standardization of tissue collection, maintenance conditions, and infection protocols to ensure reproducibility .

How can researchers overcome the challenges of limited OsHV-1 genomic tools?

The limited availability of genomic tools for OsHV-1 research presents significant challenges. Researchers can overcome these limitations through several strategies:

  • Adapt existing herpesvirus tools: Modify approaches developed for better-studied herpesviruses, considering the phylogenetic relationships and potential functional homologies.

  • Develop tissue explant models: Utilize the validated tissue explant approach, which provides a controlled environment for studying OsHV-1 infection without the confounding factors present in whole animal studies .

  • Leverage heterologous expression systems: Express ORF111 in model organisms with well-established genetic tools to study specific aspects of its function.

  • Employ synthetic biology approaches: Create chimeric viruses or proteins combining elements of OsHV-1 and better-characterized herpesviruses to enable more sophisticated genetic manipulations.

  • Develop oyster cell lines: Invest in establishing stable oyster cell lines that support OsHV-1 replication, which would dramatically expand the available experimental approaches.

  • Utilize CRISPR-Cas systems: Adapt CRISPR-Cas genome editing technologies for use in oyster cells or tissues to enable targeted modifications of host factors interacting with ORF111.

These approaches can help overcome the current limitations in the OsHV-1 research toolkit and enable more sophisticated studies of ORF111 function.

What are the most promising research avenues for understanding ORF111 (ORF110) function in OsHV-1 pathogenesis?

The most promising research avenues for understanding ORF111 (ORF110) function include:

  • Structure-function studies: Determining the three-dimensional structure of ORF111 and identifying functional domains through targeted mutagenesis would provide fundamental insights into its mechanisms of action.

  • Host-pathogen interaction mapping: Comprehensive identification of host cellular proteins that interact with ORF111 could reveal its role in viral entry, replication, or immune evasion.

  • Comparative virology: Analyzing functional similarities between ORF111 and analogous proteins in better-characterized herpesviruses may illuminate conserved mechanisms of herpesvirus pathogenesis .

  • Tissue-specific activities: Investigating whether ORF111 functions differently in various oyster tissues using the explant model system could explain patterns of viral tropism and pathology .

  • Genetic diversity analysis: Examining sequence variations in ORF111 across different OsHV-1 strains and correlating these with virulence phenotypes may identify critical functional regions.

  • Vaccine development: Evaluating recombinant ORF111 as a potential subunit vaccine candidate or developing attenuated OsHV-1 strains with modified ORF111 for immunization strategies.

These research directions would significantly advance our understanding of ORF111's role in OsHV-1 biology and potentially inform strategies for mitigating the impact of this economically important pathogen on oyster aquaculture.

How might understanding ORF111 (ORF110) contribute to disease management strategies in oyster aquaculture?

Understanding ORF111 (ORF110) could significantly impact disease management strategies in oyster aquaculture through several pathways:

  • Targeted antiviral development: If ORF111 proves essential for viral replication or pathogenesis, it could become a target for rational design of antiviral compounds specific to OsHV-1.

  • Improved diagnostics: Knowledge of ORF111 sequence variation across viral strains could lead to more sensitive and specific diagnostic tests, enabling earlier detection and containment of outbreaks.

  • Selective breeding programs: Identifying oyster genetic variants with resistance to OsHV-1 based on reduced susceptibility to ORF111-mediated effects could inform selective breeding programs for disease-resistant oyster stocks.

  • Recombinant vaccine candidates: If ORF111 elicits protective immune responses, recombinant protein-based vaccines could be developed for oyster immunization, potentially through immersion or injection protocols.

  • Environmental management: Understanding the molecular mechanisms of infection and viral entry mediated by ORF111 could inform environmental management strategies to reduce viral transmission in aquaculture settings.

The tissue explant model provides an excellent platform for testing these applications under controlled laboratory conditions before implementing more resource-intensive field trials .

What comparative approaches between ORF111 (ORF110) and human herpesvirus proteins might yield translational insights?

Comparative approaches between ORF111 (ORF110) and human herpesvirus proteins could yield valuable translational insights:

  • Conserved structural motifs: Identifying shared structural elements between ORF111 and human herpesvirus transmembrane proteins could reveal fundamental mechanisms of herpesvirus membrane fusion and entry that transcend host species boundaries.

  • Immune evasion strategies: Comparing how ORF111 and human herpesvirus proteins such as KSHV's vIRFs interfere with host immune responses may highlight conserved targets in antiviral pathways . These insights could inform the development of broad-spectrum antiviral approaches.

  • Host protein interactions: Determining whether ORF111 and human herpesvirus proteins target similar host factors could reveal evolutionarily conserved virus-host interactions critical for herpesvirus biology.

  • Drug development platforms: Established drug development pipelines targeting human herpesvirus proteins could be adapted for OsHV-1 if sufficient structural or functional similarities with ORF111 are identified.

  • One Health applications: Understanding the parallels between herpesvirus pathogenesis in different host species contributes to the One Health paradigm, recognizing the interconnection between human, animal, and environmental health.

These comparative approaches not only advance our understanding of ORF111 but may also yield insights applicable to human herpesvirus infections, demonstrating the value of studying diverse viral systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.