Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF72 (ORF72)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Ostreid herpesvirus 1 Uncharacterized Protein ORF72 (ORF72)

Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF72 (ORF72) is a protein encoded by the ORF72 gene of the Ostreid herpesvirus 1 (OsHV-1) . OsHV-1 is a virus known to cause significant mortality in oysters, particularly the Pacific oyster (Crassostrea gigas) . ORF72 is one of several open reading frames (ORFs) in the OsHV-1 genome . Although ORF72 is currently annotated as "uncharacterized," research suggests it encodes a putative membrane protein that may play a role in the virus's interaction with host cells .

Characteristics and Properties

  • Location: ORF72 is a protein that is located on the membrane of the virus .

  • Length: The protein encoded by ORF72 is 188 amino acids long .

  • Expression: Studies have shown that mRNA transcripts of ORF72 are detectable early in the OsHV-1 infection cycle, suggesting that the protein is produced relatively early during infection .

  • Function: It is believed that ORF72, along with other proteins, aids in the attachment of the virus to oyster cells .

Role in Viral Infection and Immunity

ORF72's precise function is still under investigation, available data suggests its involvement in the viral infection process:

  • Attachment and Entry: ORF72 is suspected to be involved in the early interactions between OsHV-1 and its host cells. Antibodies against ORF72 have been used to explore these initial interactions, suggesting that ORF72 may play a role in the virus's ability to attach to and enter host cells .

  • Apoptosis Inhibition: Some studies suggest that other proteins of OsHV-1, like those containing a baculovirus inhibition of apoptosis protein repeat (BIR) domain, might inhibit apoptosis, preventing cell death and allowing the virus to continue its replication. ORF72 is associated with these proteins .

  • Tissue Tropism: Research indicates that OsHV-1 proteins, including ORF72, can be detected in various oyster tissues during infection, suggesting a broad tissue tropism .

Research and Detection Methods

Several methods are used to study ORF72 and its role in OsHV-1 infection:

  • Immunohistochemistry (IHC): IHC assays using antibodies against ORF72 have been employed to analyze the localization and distribution of the protein in oyster tissues during experimental viral challenges .

  • Real-Time PCR: Real-time PCR assays are used to detect and quantify OsHV-1 RNA, including transcripts of the ORF72 gene, at different time points post-infection .

  • In situ Hybridization (ISH): ISH is used to visualize the distribution of OsHV-1 RNA and DNA in oyster tissues, providing a spatial context for gene expression .

  • Polyclonal Antibodies: Polyclonal antibodies targeting ORF72 have been produced and used in various assays to detect and study the protein .

Potential Applications

Although research on ORF72 is ongoing, potential applications arising from its study include:

  • Diagnostics: Detecting ORF72 can help screen for the presence of OsHV-1, including in persistent infections, contributing to a better understanding of viral pathogenesis .

  • Therapeutics: Identifying the function of ORF72 could lead to the development of targeted antiviral strategies to disrupt the virus's interaction with host cells .

  • Selective Breeding: Discovering genetic markers linked to OsHV-1 resistance can aid in selective breeding programs to enhance resistance in oyster populations .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ORF72; Uncharacterized protein ORF72
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)
Target Names
ORF72
Target Protein Sequence
MATDQQDLDIISSTAELRGACDFWETRSGGVTTITITRINRDAIVLLAGVCPGESFSVSY NKEKILVNSYPFNINNVDVVGGTTDINDFNSKMKSLYLPVNGMTVLMLTEGRINNPEIAV VTEDGNLEVVGSKKKTLVKLLLLFLSLMVVIVGVWWKYFSTSELSASALFDTVGQSVKSK GNYEDLFK
Uniprot No.

Target Background

Database Links

KEGG: vg:2948265

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is ORF72 in Ostreid herpesvirus 1 and what is its significance?

ORF72 is a putative membrane protein encoded by the Ostreid herpesvirus 1 (OsHV-1), a virus belonging to the Malacoherpesviridae family that infects various bivalve mollusks, particularly Pacific oysters (Crassostrea gigas). The significance of ORF72 lies in its role during viral infection processes, particularly in the early stages of virus-host interactions. Research has demonstrated that ORF72 is likely involved in attachment of the virus to host cells, contributing to viral entry mechanisms . Additionally, ORF72 appears to function in the transport of viral particles within infected cells by interacting with host cytoskeletal components, particularly tubulins . The protein has a molecular mass of approximately 25 kDa, consistent with its predicted size based on genomic sequence analysis . Understanding ORF72 function is critical for developing intervention strategies against OsHV-1 infections in economically important shellfish species.

How does ORF72 contribute to OsHV-1 pathogenesis?

ORF72 contributes to OsHV-1 pathogenesis through multiple mechanisms that facilitate viral entry and intracellular trafficking. Experimental evidence indicates that ORF72 is expressed early in the infection cycle, with transcripts detectable just two hours after initial infection . This early expression pattern suggests ORF72 plays a role in the initial stages of infection and viral maturation.

The protein interacts with host tubulins, suggesting involvement in microtubule-dependent transport of viral particles through the cytoplasm toward the nucleus . Unlike another OsHV-1 membrane protein (ORF25) that primarily interacts with actin filaments for short-range movement, ORF72 appears specialized for long-distance transport via microtubule networks . This transport function is essential for the virus to overcome the cytoplasmic barrier and reach the nucleus where viral replication occurs.

Additionally, ORF72 has been found to interact with ABC transmembrane type-1 domain-containing proteins in host cells, which may be involved in viral maturation and release processes . Some evidence also suggests interactions with calmodulin, a calcium-binding protein that regulates cytoskeletal elements, potentially facilitating viral movement within the cell .

What experimental approaches have been used to produce recombinant ORF72?

Recombinant ORF72 (rORF72) has been successfully produced using prokaryotic expression systems, primarily E. coli. The methodological approach typically includes:

  • Gene cloning: The ORF72 gene sequence is amplified from viral genomic DNA using PCR with specific primers containing appropriate restriction enzyme sites for subsequent cloning.

  • Vector construction: The amplified ORF72 sequence is inserted into a prokaryotic expression vector (commonly pET series vectors) that typically includes a histidine (His) tag sequence for purification purposes.

  • Expression optimization: The recombinant plasmid is transformed into an E. coli expression strain (such as BL21(DE3)), and expression conditions are optimized, including IPTG concentration, temperature, and induction time.

  • Protein purification: The expressed rORF72 is purified using Ni²⁺-affinity chromatography, taking advantage of the His-tag fusion. This process has been documented to yield a distinct protein band of approximately 25 kDa when analyzed by SDS-PAGE .

The purified recombinant protein is then validated through Western blotting using anti-His antibodies or specific anti-ORF72 polyclonal antibodies to confirm identity and purity before use in functional studies such as pull-down assays or antibody production .

What protein-protein interactions have been identified for ORF72 and what do they reveal about its function?

Pull-down assays using recombinant ORF72 as bait have identified several host hemocyte proteins that interact with this viral protein. Mass spectrometry analysis of these protein interactions has revealed multiple functional categories of interacting partners. The primary interactions can be summarized in the following table:

Functional CategoryKey Interacting ProteinsPotential Functional Significance
CytoskeletonTubulins (primary)Long-distance transport of viral particles through cytoplasm
Energy MetabolismATP synthase, Glycolytic enzymesEnergy supply for virus-mediated transport processes
Membrane TransportABC transmembrane type-1 domain proteinsPotential role in virion maturation and release
SignalingCalmodulinRegulation of cytoskeletal dynamics during viral transport
Nucleic Acid ProcessingVarious RNA/DNA binding proteinsPossible role in viral genome packaging or replication

Protein-protein interaction (PPI) network analysis using STRING clustering via K-means has categorized these interactions into three primary clusters predominantly associated with cytoskeleton assembly, energy metabolism, and nucleic acid processing . Unlike ORF25 (another OsHV-1 membrane protein) which primarily interacts with actins, ORF72 shows preferential binding to tubulins, suggesting functional specialization in the viral replication cycle .

The interaction with ABC transporters is particularly intriguing as these proteins normally function to expel solutes from the cytosol or into subcellular organelles. This interaction may indicate a role for ORF72 in the late stages of viral replication, potentially in virion maturation and release, or possibly in immune evasion strategies .

How can antibodies against ORF72 be utilized to study viral entry and pathogenesis?

Antibodies against ORF72 have proven valuable for investigating virus-host interactions and potential intervention strategies. Several methodological approaches include:

  • Viral entry inhibition studies: Anti-ORF72 polyclonal antibodies have been used in blocking experiments to assess their ability to prevent viral attachment and entry into host cells. In these studies, viral suspensions are pre-incubated with anti-ORF72 antibodies before exposing them to host cells or organisms. The subsequent viral load is measured by quantitative PCR detection of viral DNA or RNA transcripts, allowing researchers to evaluate the involvement of ORF72 in initial infection stages .

  • In vivo functional studies: Antibody blocking experiments have been performed in oyster spat (juvenile oysters) to assess mortality rates following exposure to OsHV-1 suspensions with or without antibody treatment. These studies have revealed that while ORF25 appears to be the primary protein involved in virus-host interactions, ORF72 and ORF41 also contribute significantly to the infection process .

  • Protein localization: Immunofluorescence or immunohistochemistry techniques using anti-ORF72 antibodies can reveal the temporal and spatial expression patterns of ORF72 during infection, providing insights into its functional role.

  • Co-immunoprecipitation: Anti-ORF72 antibodies can be used to pull down the protein from infected cells, enabling identification of additional in vivo interaction partners through mass spectrometry analysis.

These antibody-based approaches have contributed to understanding that ORF72, while important, may play a supportive role to other viral membrane proteins like ORF25 in the initial virus-host interaction processes .

What is known about the molecular mechanisms of ORF72 interactions with the host cytoskeleton?

The molecular mechanisms underlying ORF72 interactions with the host cytoskeleton, particularly with tubulin components, reveal a sophisticated strategy for viral transport within infected cells. Current research indicates several key aspects of these interactions:

  • Selective microtubule association: Unlike ORF25 which predominantly interacts with actin filaments, ORF72 shows preferential binding to tubulins, suggesting a specialized role in long-distance transport of viral particles from the cell periphery toward the nucleus . This functional division between viral membrane proteins may represent an evolutionary adaptation for efficient viral trafficking.

  • Energy-dependent transport: Pull-down assays have identified numerous energy metabolism-related proteins in association with ORF72, suggesting that the virus-mediated transport along microtubules is an energy-consuming process . These proteins may form a complex with ORF72 to ensure sufficient ATP supply for the molecular motors that drive transport along microtubules.

  • Regulatory protein involvement: The identification of calmodulin among ORF72-interacting proteins suggests a regulatory mechanism for cytoskeletal dynamics during viral transport . Calmodulin, as an intracellular calcium-binding protein, regulates several enzymes that directly affect cytoskeletal elements. Previous research with Epstein-Barr virus (EBV) has shown that calmodulin inhibitors can block infection, suggesting a conserved mechanism across different herpesviruses .

  • Early expression kinetics: Transcription of ORF72 occurs early in the infection cycle (within 2 hours), consistent with its proposed role in initial virion transport following entry . This timing aligns with the need for rapid establishment of infection before host defense mechanisms can respond effectively.

The selective use of tubulins by ORF72 represents an adaptation to the cytoplasmic environment of bivalve hemocytes, potentially offering a specialized transport pathway distinct from other viral membrane proteins.

How might ORF72 be targeted for antiviral intervention strategies?

Several potential approaches for targeting ORF72 as an antiviral strategy have emerged from current research:

  • Antibody-based interventions: Polyclonal antibodies against ORF72 have demonstrated some efficacy in reducing viral infection in experimental settings . While antibodies against ORF25 showed stronger inhibitory effects, a combinatorial approach targeting multiple viral membrane proteins including ORF72 might provide more comprehensive protection. This strategy could be implemented through passive immunization in controlled aquaculture environments.

  • Synthetic peptide inhibitors: Based on the identified interaction domains between ORF72 and host tubulins, synthetic peptides could be designed to competitively inhibit these interactions, preventing efficient viral transport within host cells. This approach would require detailed structural characterization of the ORF72-tubulin binding interface.

  • Cytoskeletal modulators: Since ORF72 relies on interaction with the host cytoskeleton for viral transport, compounds that selectively disrupt microtubule dynamics without significant toxicity to host cells could be effective antiviral agents. Research with other herpesviruses has demonstrated that cytoskeletal inhibitors can significantly reduce viral replication .

  • Sulfated polysaccharide treatments: Dextran sulfate, a negatively charged sulfated polysaccharide, has shown promise in reducing oyster spat mortality in experimental OsHV-1 infections at concentrations of 30 μg/mL . This compound may interfere with the interactions between viral membrane proteins (including ORF72) and host cell receptors. Further studies could optimize such treatments for aquaculture applications.

  • ABC transporter modulation: Given ORF72's interaction with ABC transporters, compounds that modulate these transmembrane proteins might interfere with viral maturation and release processes . This represents a novel target pathway distinct from entry inhibition strategies.

Development of these intervention strategies would benefit from more comprehensive structural and functional characterization of ORF72 and its interaction networks.

What pull-down assay protocols are most effective for studying ORF72 interactions with host proteins?

The most effective pull-down assay protocols for studying ORF72 interactions with host proteins involve several critical methodological considerations:

  • Bait protein preparation: Recombinant His-tagged ORF72 (rORF72) should be expressed in E. coli systems and purified using Ni²⁺-affinity chromatography to obtain a protein of approximately 25 kDa . Proper folding of the recombinant protein is essential for maintaining interaction capability, so optimization of expression conditions (temperature, time, IPTG concentration) is crucial.

  • Host cell lysate preparation: Fresh hemocytes collected from uninfected bivalves (such as ark clams or oysters) should be lysed under non-denaturing conditions to preserve the native conformation of potential interacting proteins . Typically, lysis buffers containing mild detergents (0.5% NP-40 or Triton X-100) with protease inhibitors are recommended.

  • Pull-down procedure: The purified rORF72 is immobilized on Ni²⁺-Sepharose beads and incubated with the host cell lysate, allowing potential interacting proteins to bind to rORF72. Multiple washing steps with increasing stringency help reduce non-specific binding. A control using free Ni²⁺-Sepharose beads without bait protein is essential to identify non-specific binding to the beads themselves .

  • Elution and separation: Bound proteins are eluted using imidazole or SDS-PAGE loading buffer and separated by SDS-PAGE. Specific bands that appear in the rORF72 pull-down sample but not in the control can be excised for identification.

  • Protein identification: Tandem mass spectrometry (MS/MS) analysis of the excised gel bands provides the most comprehensive identification of interacting proteins. Previous studies have successfully identified multiple distinct protein bands in rORF72 pull-down samples, yielding valuable insights into ORF72's interaction network .

  • Functional analysis: Bioinformatic analysis of the identified proteins using Gene Ontology (GO) classification and STRING protein-protein interaction (PPI) network construction with K-means clustering helps categorize the interactions into functional groups, revealing the biological processes potentially influenced by ORF72 .

This methodology has successfully identified cytoskeletal components, energy metabolism proteins, and membrane transport proteins as key interaction partners of ORF72, providing insights into its cellular functions during viral infection.

How can researchers distinguish between the functions of ORF72 and other viral membrane proteins like ORF25?

Distinguishing between the functions of different viral membrane proteins such as ORF72 and ORF25 requires complementary experimental approaches that reveal their specific roles:

By integrating these approaches, researchers have determined that while ORF25 appears primarily involved in virus-host cell attachment, potentially through interaction with actin-dependent endocytosis, ORF72 likely functions in subsequent intracellular transport processes via tubulin interactions .

What are the most significant research gaps in our understanding of ORF72 function?

Despite progress in characterizing ORF72, several significant research gaps remain that hinder complete understanding of its function:

  • Structural characterization: The three-dimensional structure of ORF72 remains undetermined, limiting our understanding of how specific domains interact with host proteins. Structural studies using X-ray crystallography or cryo-electron microscopy would provide valuable insights into functional mechanisms.

  • Precise transport mechanisms: While ORF72 has been shown to interact with tubulins, the exact molecular mechanisms of how it facilitates viral transport along microtubules remain unclear. Whether ORF72 directly interacts with molecular motors like kinesins or dynein, or requires additional viral or host adaptor proteins, needs further investigation.

  • Host cell receptor identification: The specific receptors on host cell surfaces that interact with ORF72 during viral entry have not been definitively identified. Characterizing these receptors would enhance our understanding of host range and tissue tropism.

  • Role in immune evasion: The interaction between ORF72 and ABC transporters suggests a potential role in immune evasion, but the specific mechanisms remain hypothetical . Further research is needed to determine whether ORF72 actively subverts host immune responses through these interactions.

  • Comparative analysis across OsHV-1 variants: Different genetic variants of OsHV-1 exist, including the particularly virulent μVar genotype . Comparative analysis of ORF72 sequence and function across these variants could reveal adaptations associated with virulence.

  • In vivo validation: Most current knowledge about ORF72 comes from in vitro studies. Validation of its proposed functions in naturally infected animals would strengthen our understanding of its role in pathogenesis.

Addressing these research gaps would significantly advance our understanding of OsHV-1 pathogenesis and potentially reveal new targets for intervention strategies to combat infections in economically important bivalve species.

How might future research directions on ORF72 contribute to antiviral development for aquaculture applications?

Future research on ORF72 holds significant promise for antiviral development in aquaculture settings through several strategic directions:

  • Structure-guided inhibitor design: Detailed structural characterization of ORF72, particularly its interaction interfaces with host proteins like tubulins, could enable rational design of specific inhibitors that block these interactions without affecting host cellular functions.

  • Combinatorial targeting strategies: Research exploring the synergistic effects of simultaneously targeting multiple viral membrane proteins (ORF25, ORF41, and ORF72) could lead to more robust protection strategies, as preliminary studies have shown enhanced protective effects when all three proteins are targeted .

  • Development of recombinant vaccines: Using recombinant ORF72 as part of a subunit vaccine formulation could potentially stimulate protective immunity in bivalves. While traditional adaptive immunity is limited in mollusks, trained immunity approaches might be effective.

  • Environmental intervention compounds: Building on the promising results with dextran sulfate , screening for other compounds that interfere with ORF72-host interactions but are suitable for application in aquaculture environments could lead to practical intervention strategies.

  • Genetic selection programs: Understanding the molecular interactions between ORF72 and host proteins could inform genetic selection programs for oysters with naturally occurring variations in interaction partners that confer reduced susceptibility to OsHV-1 infection.

  • Cross-species protection strategies: Investigating whether knowledge of ORF72 function in OsHV-1 can be applied to related viruses affecting other commercially important aquaculture species might broaden the impact of this research.

  • Development of rapid diagnostics: Insights into ORF72 expression and localization could inform the development of improved diagnostic tools for early detection of OsHV-1 infection in aquaculture settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.