Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF84 (ORF84)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Ostreid herpesvirus 1 Uncharacterized Protein ORF84 (ORF84)

Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF84, also known as ORF84, is a protein derived from the Ostreid herpesvirus 1 (OsHV-1) . OsHV-1 is a double-stranded DNA virus that affects oysters . Specifically, the recombinant form of ORF84 is produced in E. coli and tagged with histidine (His) at the N-terminus to facilitate its purification and identification .

Basic Information

CategoryDescription
Full NameRecombinant Full Length Ostreid Herpesvirus 1 Uncharacterized Protein Orf84(Orf84) Protein, His-Tagged
SpeciesOstreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-118 amino acids)
PurityGreater than 90% as determined by SDS-PAGE
SynonymsORF84; Uncharacterized protein ORF84
UniProt IDQ6R7E5
Amino Acid SequenceMVQGYIHGLDSYNINEASLLIRSDLVKVVEAITGNNDASYIFLLIIITIIFALTMYTSVQVLIRTMRTTISKSVMDDNLKKKYGFERMRNKKRKKRSNATDTAILMNTMLDDDSTDEF
Molecular WeightNot found in the provided documents.
Storage ConditionsStore at -20°C/-80°C upon receipt, with aliquoting recommended for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20℃/-80℃ is recommended .
ApplicationsNot found in the provided documents.
Related ProductsRecombinant Proteins
Involved PathwaysPathways are listed for orf84, but are not specified in the provided documents .
Protein FunctionFunctions are listed for orf84, but are not specified in the provided documents .
Interacting ProteinsInteracting proteins and molecules are listed for orf84, but are not specified in the provided documents .

Function and Significance

The protein is currently annotated as an uncharacterized protein . Studies suggest that certain genomic regions of OsHV-1, including those where ORF84 is located, exhibit variability across different isolates, implying potential selective pressures and functional relevance . Further studies are necessary to elucidate the precise role of ORF84 in the viral life cycle and its impact on host-virus interactions.

Expression and Role in Viral Infection

ORF45, a protein from Kaposi’s sarcoma-associated herpesvirus (KSHV), serves as a reference point for understanding herpesvirus proteins. ORF45 is expressed as an immediate-early gene during the lytic cycle . Transcriptomic analyses have shown that ORF45 mRNA accumulates rapidly in host cells following KSHV infection, suggesting its crucial role in de novo infection and lytic reactivation .

Genomic Diversity and Evolution

Genomic studies of OsHV-1 reveal diversity and evolution over time. Specific genomic regions, including those near ORF84, exhibit deletions and substitutions, indicating selective pressures . These deletions are not entirely random and tend to occur in specific regions of the viral genome . The functional implications of these genetic variations, particularly in the ORF84 region, warrant further investigation to understand their impact on viral adaptation and virulence.

Potential Applications in Research

Recombinant ORF84 can be utilized in research applications such as:

  • Antibody Production: For generating antibodies that specifically target ORF84, aiding in detection and functional studies of the protein.

  • Protein Interaction Studies: To identify interacting partners of ORF84 within the host cell or virus, providing insights into its function .

  • Structural Studies: To determine the three-dimensional structure of ORF84, which can provide clues about its function and potential drug targets.

  • Functional Assays: To investigate the role of ORF84 in viral replication, immune evasion, or pathogenesis .

Limitations and Future Directions

Current annotations of ORF84 offer limited functional information . Future research should focus on:

  • Functional Characterization: Conducting experiments to determine the precise biochemical and biological functions of ORF84.

  • Structural Analysis: Determining the three-dimensional structure of ORF84 to gain insights into its mechanism of action.

  • Interaction Studies: Identifying host and viral proteins that interact with ORF84 to map its role in the OsHV-1 infection cycle .

  • Comparative Genomics: Analyzing the sequence variability of ORF84 across different OsHV-1 isolates to understand its adaptive evolution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ORF84; Uncharacterized protein ORF84
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus)
Target Names
ORF84
Target Protein Sequence
MVQGYIHGLDSYNINEASLLIRSDLVKVVEAITGNNDASYIFLLIIITIIFALTMYTSVQ VLIRTMRTTISKSVMDDNLKKKYGFERMRNKKRKKRSNATDTAILMNTMLDDDSTDEF
Uniprot No.

Target Background

Database Links

KEGG: vg:2948237

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Ostreid herpesvirus 1 (OsHV-1) and why is ORF84 important?

Ostreid herpesvirus 1 (OsHV-1) is a double-stranded DNA virus belonging to the family Malacoherpesviridae, order Herpesvirales. It is the causative agent of Pacific oyster mortality syndrome (POMS), which has significantly impacted oyster aquaculture worldwide, particularly affecting Crassostrea gigas (Pacific oyster) .

ORF84 encodes a capsid-associated protein that plays a structural role in the virus. This protein is particularly important because:

  • It is one of the most expressed viral genes during infection

  • It can be detected early in infection (from 4 hours post-infection)

  • It shows a distinctive expression pattern with an 8-10 fold increase during the first 5 days post-infection

  • As a structural component, it represents a potential target for diagnostic tests and antiviral interventions

Understanding ORF84 provides insights into viral assembly, structure, and potential vulnerabilities that could be exploited for disease management strategies.

What methods are used to express recombinant OsHV-1 ORF84 protein?

Several methodological approaches have been developed to express recombinant OsHV-1 ORF84 protein:

Prokaryotic Expression Systems:

  • E. coli expression: The ORF84 coding sequence can be amplified using PCR and cloned into bacterial expression vectors (such as pET series vectors) with an N-terminal His-tag for purification .

  • Codon optimization: Since viral codon usage may differ from bacterial systems, codon optimization is often necessary to improve expression efficiency.

  • Inclusion body solubilization: ORF84 may form inclusion bodies requiring solubilization using 8M urea followed by refolding protocols.

Eukaryotic Expression Systems:

  • Baculovirus expression: For better folding and post-translational modifications, the ORF84 coding sequence can be cloned into baculovirus transfer vectors and expressed in insect cells.

  • Mammalian cell expression: For functional studies, ORF84 can be cloned into mammalian expression vectors and transfected into cell lines such as HEK293T.

Purification Approaches:

  • Affinity chromatography using Ni-NTA columns for His-tagged proteins

  • Size exclusion chromatography for further purification

  • Ion exchange chromatography to remove contaminants

The choice of expression system depends on downstream applications such as structural studies, antibody production, or functional characterization.

How can researchers confirm the authenticity of recombinant ORF84 expression?

Verification of recombinant ORF84 expression and authenticity requires multiple complementary approaches:

Molecular Confirmation:

  • Western blotting: Using either anti-His tag antibodies (if tagged) or specific antibodies against ORF84

  • Mass spectrometry: For peptide mass fingerprinting and sequence verification

  • N-terminal sequencing: To confirm the correct translation start site

Functional Validation:

  • Structure-based analyses: Secondary structure analysis using circular dichroism

  • Size verification: Size exclusion chromatography or dynamic light scattering to confirm expected molecular weight and oligomeric state

  • Immunofluorescence assays (IFA): To confirm antigenicity and cross-reactivity with anti-OsHV-1 antibodies

Expression Level Assessment:

  • SDS-PAGE with densitometric analysis: To quantify expression levels

  • ELISA: For quantitative determination of recombinant protein yield

A typical validation workflow should include at least three independent methods to conclusively verify the authenticity of the recombinant ORF84 protein before proceeding to functional studies.

What is known about the temporal expression pattern of ORF84 during viral infection?

ORF84 exhibits a distinct temporal expression pattern during OsHV-1 infection:

Expression Timeline:

  • Early detection: The capsid-associated antigen encoded by ORF84 is first detected at 4 hours post-infection (hpi) using confocal microscopy and image analysis

  • Expression increase: During the first 5 days post-infection, there is an 8-10 fold increase in capsid-associated protein expression

  • Differential expression: ORF84 shows significantly higher expression increases compared to envelope glycoproteins, which show ≤2-fold increases during the same period

Cellular Localization Patterns:

  • At early stages (4 hpi), similar levels of cytoplasmic and nuclear-associated protein are observed

  • As infection progresses, distribution changes with increased nuclear localization corresponding to viral assembly

Quantitative Expression Data:

Time Post-InfectionRelative ORF84 Expression (Fold Change)Cellular Localization
0 hours1.0 (baseline)Not detected
4 hoursDetectableEqual cytoplasmic/nuclear
24 hours~4-fold increaseIncreasing nuclear
5 days8-10 fold increasePredominantly nuclear

This expression pattern indicates that ORF84 is a key structural protein involved in capsid assembly during the viral replication cycle, making it a potential target for diagnostic development and therapeutic intervention.

How does the structural characterization of ORF84 contribute to understanding OsHV-1 capsid assembly?

Structural characterization of ORF84 provides critical insights into OsHV-1 capsid assembly and virus-host interactions:

Structural Approaches and Findings:

  • Protein modeling: Homology modeling based on other herpesvirus capsid proteins suggests ORF84 contributes to the floor domain of hexons and pentons in the capsid structure

  • Cryo-electron microscopy: Can reveal the spatial arrangement of ORF84 within the viral capsid and its interaction interfaces with other structural proteins

  • X-ray crystallography: Of the recombinant protein can identify key structural motifs involved in protein-protein interactions during assembly

Functional Domains:
Analysis of the ORF84 sequence and structure reveals:

  • N-terminal domains likely involved in capsid floor formation

  • Central regions containing conserved structural elements shared with other herpesvirus capsid proteins

  • C-terminal regions potentially involved in interactions with scaffolding proteins during assembly

Assembly Interactions:

  • ORF84 likely interacts with other highly expressed structural proteins, including those encoded by viral genes with similar expression patterns

  • The spatiotemporal coordination of ORF84 expression with other structural proteins (8-10 fold increase during first 5 days) suggests a regulated assembly process

Understanding these structural aspects is crucial for developing strategies to disrupt capsid assembly as a potential antiviral approach. The high conservation of capsid proteins among OsHV-1 variants makes ORF84 a particularly valuable target for broad-spectrum interventions.

What experimental approaches can be used to investigate ORF84 interactions with host immune factors?

Investigating interactions between ORF84 and host immune factors requires sophisticated experimental approaches:

Protein-Protein Interaction Studies:

  • Yeast two-hybrid screening: To identify oyster proteins that interact with ORF84

  • Co-immunoprecipitation: Using anti-ORF84 antibodies to pull down host interaction partners

  • Proximity labeling: BioID or APEX2 fusions to ORF84 can identify proteins in close proximity within host cells

  • Surface plasmon resonance (SPR): For measuring binding kinetics and affinity to purified host immune factors

Functional Immune Assays:

  • In vitro hemocyte challenge: Exposing oyster hemocytes to recombinant ORF84 and measuring immune gene expression

  • Neutralization assays: Testing if anti-ORF84 antibodies can neutralize viral infectivity

  • Vaccine studies: Using recombinant ORF84 as a subunit vaccine candidate and measuring protection

Gene Expression Analysis:

Experimental ConditionCgMyD88-1 ExpressionCgMyD88-2 ExpressionCgMyD88s Expression
ControlBaselineBaselineBaseline
OsHV-1 μVar challengeUpregulatedUpregulatedDownregulated
ORF84 protein exposure[Research gap][Research gap][Research gap]

Analysis of immune responses specifically to ORF84 represents a research gap, as current studies have examined whole virus challenges but not individual protein effects on host immunity. The differential regulation of immune factors like CgMyD88 variants during OsHV-1 infection suggests complex immune responses that might be partly driven by capsid proteins like ORF84 .

How can researchers develop an ORF84-based detection system for early diagnosis of OsHV-1 infection?

Developing an ORF84-based detection system requires leveraging the unique characteristics of this structural protein:

Molecular Detection Methods:

  • Quantitative PCR: Designing primers/probes targeting ORF84 gene for sensitive viral DNA detection

  • Droplet digital PCR: For absolute quantification with higher sensitivity than conventional qPCR

  • LAMP (Loop-mediated isothermal amplification): For field-deployable rapid detection targeting ORF84

Protein-Based Detection Systems:

  • ELISA development: Using recombinant ORF84 protein to generate specific antibodies for antigen detection

  • Lateral flow assays: Development of field-deployable immunochromatographic tests

  • Biosensor platforms: Surface-functionalized with anti-ORF84 antibodies for real-time detection

Performance Optimization:

Detection MethodLower Detection LimitTime to ResultField ApplicabilitySample Type
qPCR (ORF84)10 viral copies/μL2-3 hoursLaboratoryTissue, hemolymph
LAMP (ORF84)100 viral copies/μL30-60 minField adaptableTissue, hemolymph
ELISA5-10 ng/mL protein3-4 hoursLaboratoryTissue homogenate
Lateral flow50-100 ng/mL protein15-30 minField readyHemolymph

Validation Strategy:

  • Analytical validation using recombinant proteins and inactivated virus

  • Testing with experimentally infected oysters at different time points to determine earliest detection window

  • Field validation in areas with known OsHV-1 outbreaks

  • Comparison with existing detection methods (conventional PCR, histopathology)

Early detection is crucial given that ORF84 expression is detectable from 4 hpi and increases significantly over 5 days , providing a viable window for early intervention before mortality occurs.

What strategies can be employed to analyze potential epitope regions within ORF84 for vaccine development?

Systematic epitope analysis of ORF84 provides foundation for rational vaccine design:

Computational Epitope Prediction:

  • B-cell epitope prediction: Using algorithms that evaluate hydrophilicity, flexibility, accessibility, and antigenicity

  • T-cell epitope prediction: MHC binding prediction tools adapted for mollusk systems

  • Conservation analysis: Comparing sequences across different OsHV-1 variants to identify conserved epitope regions

  • Structural prediction: Mapping predicted epitopes onto 3D structural models to confirm surface exposure

Experimental Epitope Mapping:

  • Peptide array analysis: Overlapping peptides spanning the entire ORF84 sequence screened against sera from recovered oysters

  • Phage display: For identifying immunodominant epitopes through biopanning with oyster antibodies

  • Hydrogen-deuterium exchange mass spectrometry: To identify surface-exposed regions amenable to antibody recognition

  • Truncation and mutation studies: To pinpoint essential antigenic regions

Immunogenicity Testing Framework:

Epitope Delivery MethodAdvantagesLimitationsAssessment Metrics
Synthetic peptidesPrecise epitope deliveryLimited conformational epitopesAntibody titer, survival rate
Recombinant protein fragmentsBetter conformational epitopesProduction complexityNeutralizing capacity, survival
DNA vaccinesIn vivo expressionDelivery challenges in oystersGene expression, survival
Viral vector displayMultivalent presentationSafety concernsProtection level, duration

Validation in Challenge Models:

  • Immunization trials using different delivery methods and adjuvants

  • Measurement of specific antibody responses

  • Challenge with virulent OsHV-1 to assess protection

  • Correlation of epitope-specific responses with survival outcomes

Given that previous exposure to OsHV-1 can result in immunity with 118 times lower risk of mortality than naive oysters , identifying the key protective epitopes within major structural proteins like ORF84 offers promise for vaccine development.

How can researchers investigate the potential role of ORF84 in viral transmission dynamics between infected and naïve oysters?

Investigating ORF84's role in viral transmission requires sophisticated experimental designs:

Transmission Study Models:

  • Cohabitation experiments: Placing ORF84-immunized oysters with infected individuals to assess transmission blockade

  • Water-borne transmission studies: Using filtered water from infected tanks to challenge naïve oysters with or without anti-ORF84 neutralizing antibodies

  • Direct injection models: Comparing transmission efficiency of wild-type virus versus manipulated virus with altered ORF84

Molecular Tracking Approaches:

  • Viral load quantification: Using ORF84-specific qPCR to track viral loads in donor and recipient oysters over time

  • Expression analysis: Measuring ORF84 transcript levels at different stages of infection and relating to transmission efficiency

  • Protein detection: Using immunohistochemistry to track ORF84 protein localization in tissues involved in viral shedding

Transmission Parameters Analysis:

Experimental ConditionTransmission Rate (%)Viral Load in RecipientsTime to Detection in Recipients
Naïve recipients70-90%High (10⁵-10⁶ copies/mg)24-48 hours
ORF84-immunized[Research gap][Research gap][Research gap]
Anti-ORF84 antibody passive transfer[Research gap][Research gap][Research gap]

Environmental Factors Assessment:

  • Temperature effects on ORF84 expression and transmission (thermal shock experiments)

  • Salinity impacts on capsid stability and transmission efficiency

  • Water flow rates and their influence on transmission dynamics

This research is particularly important considering that adult C. gigas can carry OsHV-1 infection for lengthy periods, but reactivation of viral replication leading to mortality and transmission may require specific conditions . Understanding the role of structural proteins like ORF84 in maintaining viral integrity during transmission is crucial for developing intervention strategies.

What are the optimal conditions for expressing and purifying recombinant ORF84 protein to maintain structural integrity?

Optimizing expression and purification of recombinant ORF84 requires careful parameter tuning:

Expression Optimization:

  • Vector selection: pET-based systems with T7 promoter for bacterial expression; pFastBac for baculovirus expression

  • Host strain selection:

    • E. coli BL21(DE3) pLysS for reduced leaky expression

    • E. coli Rosetta for rare codon accommodation

    • Sf9 or Hi5 insect cells for eukaryotic folding environment

  • Expression conditions:

    • Temperature: 16-18°C for slower expression to improve folding

    • Induction: 0.1-0.5 mM IPTG for bacterial systems

    • Media: TB or auto-induction media for higher yields

Purification Strategy Optimization:

Purification StepBuffer ConditionsCritical ParametersQuality Control
Cell lysis50 mM Tris pH 8.0, 300 mM NaCl, 1 mM PMSFGentle lysis to prevent aggregationMicroscopy check
IMAC (Ni-NTA)+ 20-40 mM imidazole for binding, 250-300 mM for elutionFlow rate: 0.5-1 ml/minSDS-PAGE, Western blot
Size exclusion25 mM Tris pH 7.5, 150 mM NaClColumn selection: Superdex 200Dynamic light scattering
Ion exchange20 mM phosphate buffer pH 7.0 with salt gradientGradient optimization: 0-500 mM NaClPurity assessment

Structural Integrity Assessment:

  • Circular dichroism to confirm secondary structure content

  • Thermal shift assays to assess stability under different buffer conditions

  • Limited proteolysis to identify stable domains

  • Negative-stain electron microscopy to check for proper folding and assembly

Storage Optimization:

  • Stability testing at different temperatures (-80°C, -20°C, 4°C)

  • Cryoprotectant screening (glycerol, sucrose, trehalose)

  • Lyophilization trials with appropriate excipients

Based on research with other capsid proteins, adding molecular chaperones like GroEL/GroES to the expression system may significantly improve the yield of correctly folded ORF84 protein .

How can researchers design effective CRISPR/Cas9 approaches to study ORF84 function in the viral life cycle?

CRISPR/Cas9 approaches offer powerful tools for studying ORF84 function, though they require careful design for viral genome editing:

Target Site Selection:

  • Conserved regions analysis: Identifying highly conserved regions within ORF84 across viral variants

  • Critical domain targeting: Focusing on regions predicted to be essential for capsid assembly

  • PAM site identification: Screening for optimal S. pyogenes Cas9 PAM sites (NGG) within ORF84

  • Off-target prediction: Using computational tools to minimize off-target effects within viral and host genomes

Delivery System Optimization:

  • Plasmid-based delivery: Co-transfection of Cas9 and sgRNA expression plasmids into virus-producing cells

  • Ribonucleoprotein (RNP) complex: Direct delivery of pre-formed Cas9-sgRNA complexes

  • Viral vectors: Using recombinant adenovirus or baculovirus for delivery into oyster cells

Experimental Approaches:

  • In vitro genome editing:

    • Editing viral DNA extracted from virions before transfection

    • Screening for successful edits using T7 endonuclease assay or deep sequencing

  • Cell culture editing:

    • Transfecting CRISPR components into permissive cell lines harboring viral genome

    • Analyzing viral replication after editing through qPCR and microscopy

Mutant Characterization Strategy:

Mutation TypeExpected PhenotypeAnalysis MethodsTechnical Challenges
Complete knockoutNon-viable virusViral DNA quantificationRequires complementation
Domain-specific mutationsStructural defectsElectron microscopy, assembly assaysPrecise editing required
Tagged insertionsTraceable proteinFluorescence microscopy, IP-MSTag interference with function
Conditional systemsTemperature-sensitive mutantsComparative growth analysisComplex design required

Validation Approaches:

  • Complementation studies with wild-type ORF84 expression

  • Structural analysis of mutant virions using electron microscopy

  • Host interaction studies using proteomics

  • Trans-complementation systems for lethal mutations

This approach would advance understanding of specific roles of ORF84 in capsid assembly and stability during the viral life cycle, which is currently inferred primarily from expression patterns rather than direct functional evidence.

What bioinformatic approaches can be used to analyze ORF84 conservation and evolution across different OsHV-1 variants?

Comprehensive bioinformatic analysis of ORF84 evolution requires multi-faceted approaches:

Sequence Collection and Alignment:

  • Database mining: Retrieving all available ORF84 sequences from GenBank, EMBL, and specialized virus databases

  • Multiple sequence alignment: Using MAFFT or MUSCLE with parameters optimized for viral structural proteins

  • Phylogenetic analysis: Maximum likelihood and Bayesian methods to reconstruct evolutionary relationships

  • Recombination detection: Using RDP4 or similar tools to identify potential recombination events

Evolutionary Rate Analysis:

  • BEAST analysis: Bayesian evolutionary analysis to estimate the molecular clock rate of ORF84

  • Selection pressure analysis: Using PAML, FUBAR, or MEME to identify sites under positive or negative selection

  • Codon usage analysis: Comparing ORF84 codon usage with host genes to detect adaptation

Structural Conservation Mapping:

RegionConservation ScoreSelection PressurePredicted Function
N-terminal (aa 1-100)Moderate (70-80%)Purifying (dN/dS < 1)Host interaction domain
Core domain (aa 101-300)High (>90%)Strong purifying (dN/dS << 1)Capsid structure
C-terminal (aa 301-end)Variable (40-60%)Mixed selectionAccessory function

Comparative Genomics:

  • Synteny analysis: Examining the genomic context of ORF84 across related viruses

  • Gene content analysis: Comparing presence/absence patterns of ORF84 orthologues

  • Variant calling pipeline: Identifying SNPs and InDels across viral genomes and assessing their impact

The evolutionary rate of OsHV-1 has been estimated at approximately 6.787E-05 nucleotide substitutions per site per year , which is higher than expected for a DNA virus. Using this information, researchers can estimate the timeline of ORF84 divergence across different viral strains and host species, providing insights into host adaptation and potential for cross-species transmission.

How can researchers develop an in vitro system to study ORF84 assembly into capsid-like structures?

Developing an in vitro capsid assembly system for ORF84 requires systematic methodological approaches:

Protein Component Preparation:

  • Expression of multiple capsid proteins: ORF84 along with other putative capsid proteins identified as highly expressed

  • Optimization of protein ratios: Based on stoichiometry determined from purified virions

  • Buffer screening: Systematic testing of pH, ionic strength, and additives to promote assembly

  • Redox conditions: Optimization of oxidizing/reducing environment for proper disulfide bond formation

Assembly Reaction Design:

  • Concentration-dependent assembly: Titration of protein concentrations to determine critical assembly threshold

  • Temperature and time course: Finding optimal conditions for ordered assembly

  • Nucleic acid requirement: Testing if scaffold DNA/RNA is needed for proper assembly

  • Stepwise versus co-expression assembly: Comparing sequential addition versus simultaneous mixing

Analytical Techniques for Assembly Monitoring:

TechniqueInformation ProvidedResolutionSample Requirements
Dynamic light scatteringParticle size distributionLowMinimal preparation
Negative-stain EMBasic morphologyModerate (10-20Å)Quick sample preparation
Cryo-electron microscopyDetailed structureHigh (3-4Å)Complex preparation
Analytical ultracentrifugationAssembly kinetics, sizeModeratePurified components
Native mass spectrometrySubcomplexes, stoichiometryHighMS-compatible buffers

Assembly Validation Approaches:

  • Structural comparison with native virions using electron microscopy

  • Antibody recognition using the same antibodies that detect native capsids

  • Stability assays under various conditions (pH, temperature, salt)

  • DNA packaging assays to test functionality

This in vitro system would provide crucial insights into the assembly pathway of OsHV-1 capsids and the specific role of ORF84, which could identify critical steps for targeted intervention. The system could also be used to screen for small molecules that disrupt assembly as potential antiviral compounds.

What methodological approaches can be used to study the interaction between ORF84 and other viral structural proteins?

Investigating interactions between ORF84 and other viral structural proteins requires multi-technique approaches:

Protein-Protein Interaction Screening:

  • Yeast two-hybrid (Y2H) screening: Systematic testing of ORF84 against other viral ORFs

  • Mammalian two-hybrid assays: For verification in more native-like cellular environments

  • Split-reporter assays: Using BiFC, BRET, or FRET to visualize interactions in living cells

  • Protein complementation assays: For validation of specific interaction pairs

Structural Characterization of Complexes:

  • Crosslinking mass spectrometry (XL-MS): To identify interaction interfaces

  • Hydrogen-deuterium exchange MS: For mapping binding regions through solvent accessibility changes

  • Single-particle cryo-EM: For structural determination of multi-protein complexes

  • X-ray crystallography: For high-resolution studies of co-crystallized protein domains

Quantitative Binding Analysis:

TechniqueParameter MeasuredAdvantagesLimitations
Surface plasmon resonanceKon, Koff, KDReal-time kineticsRequires protein immobilization
Isothermal titration calorimetryKD, ΔH, ΔS, ΔGLabel-free thermodynamicsHigh protein consumption
Microscale thermophoresisKDLow sample requirementsRequires fluorescent labeling
Bio-layer interferometryKon, Koff, KDReal-time, low sample volumePotential surface effects

Functional Validation in Viral Context:

  • Co-immunoprecipitation from infected cells at different time points

  • Immunofluorescence co-localization studies during infection progression

  • Proximity labeling approaches (BioID, APEX) in infected cells

  • Mutational analysis of interface residues identified from structural studies

The expression analysis of OsHV-1 ORFs has revealed several highly expressed putative capsid proteins alongside ORF84 , making them primary candidates for interaction studies. Understanding these interactions could reveal assembly pathways and potential vulnerabilities in the viral structure.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.