Recombinant Ovibos moschatus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ovibos moschatus MC1R

The recombinant Ovibos moschatus melanocyte-stimulating hormone receptor (MC1R) is a synthetic protein derived from the Arctic muskox (Ovibos moschatus), engineered to study its role in melanin synthesis, pigmentation, and genetic adaptations. MC1R is a seven-transmembrane G protein-coupled receptor (GPCR) that regulates the switch between red/yellow pheomelanin and brown/black eumelanin production in melanocytes . Recombinant MC1R proteins are produced via heterologous expression systems, enabling functional and structural studies of this critical pigment-regulating receptor.

Functional Role of MC1R in Melanogenesis

MC1R activation by α-melanocyte-stimulating hormone (α-MSH) triggers cAMP signaling, redirecting melanin synthesis from pheomelanin to eumelanin . In Ovibos moschatus, this mechanism likely contributes to adaptive pigmentation in Arctic environments.

Key Functional Studies

Study FocusFindingsSource
Receptor Activationα-MSH binding induces cAMP upregulation via Gαs coupling
Agouti Protein AntagonismAgouti competes with α-MSH for MC1R binding, favoring pheomelanin
Loss-of-Function MutationsImpaired MC1R signaling correlates with red hair in humans

Research Applications and Genetic Insights

Genomic Context
The Ovibos moschatus genome assembly identified low genetic diversity, with MC1R as a candidate for studying Arctic adaptations . Pairwise sequentially Markovian coalescent (PSMC) analyses revealed population bottlenecks linked to glacial events, potentially influencing MC1R evolution .

Comparative MC1R Studies

SpeciesMC1R VariantCoat Color AssociationSource
Ovibos moschatusWild-type (E)Adaptive melanization
Sus scrofa (Pig)Dominant E variantsBlack coat (Duroc breed)
Homo sapiensLoss-of-function R allelesRed hair, increased melanoma risk

Production and Quality Control

Synthesis and Validation

ParameterDetailsSource
Expression HostsE. coli, Yeast, Baculovirus, or Mammalian Cells
TagsN-terminal His-tag for purification (e.g., in Leontopithecus chrysomelas MC1R)
mRNA ExpressionHigher expression levels correlate with stronger eumelanin synthesis

Challenges

  • Partial Proteins: Some recombinant MC1R constructs are truncated (e.g., Chaetodipus penicillatus MC1R), limiting functional studies .

  • Expression Optimization: Achieving sufficient MC1R expression levels for dominant eumelanin synthesis remains critical .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; MSHR; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Ovibos moschatus (Muskox)
Target Names
Target Protein Sequence
MPALGSQRRLLGSLNCTPPATLPLTLAPNRTGPQCLEVSIPNGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYYFVCCLAMSDLLVSVSNVLETAVMLLLEAGVLATQAAVVQQLDNVI DVLICSSMVSSLCFLGAIAVDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSVLSI TYYNHTVVLLCLVGFFIAMLALMAVLYVHMLARACRHARGIARLQKRQRPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW
Uniprot No.

Target Background

Function
This receptor binds to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage conditions for recombinant Ovibos moschatus MC1R protein?

For optimal stability and activity maintenance of recombinant muskox MC1R protein, the recommended storage conditions are:

  • Short-term storage (up to one week): 4°C in working aliquots

  • Medium-term storage: -20°C

  • Long-term storage: -20°C or -80°C

The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein . To preserve protein integrity, repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise structural stability and functional activity. The best practice is to prepare single-use aliquots upon initial thawing. When designing experiments, researchers should account for potential protein loss during each freeze-thaw cycle and include appropriate controls to verify protein activity.

What are the most effective approaches for studying MC1R signaling in vitro using recombinant proteins?

Investigating MC1R signaling using recombinant proteins requires a multifaceted approach:

Cell-Based Assays:

  • Transfection of MC1R expression constructs into melanocyte cell lines or HEK293 cells

  • Stimulation with α-MSH or other melanocortin agonists at various concentrations (typically 10⁻¹⁰ to 10⁻⁶ M)

  • Measurement of cAMP accumulation using ELISA or reporter gene assays

Binding Assays:

  • Competitive binding assays using radiolabeled or fluorescently-labeled ligands

  • Surface plasmon resonance (SPR) to determine binding kinetics and affinity constants

  • Fluorescence resonance energy transfer (FRET) for real-time interaction monitoring

Downstream Signaling Analysis:

  • Western blotting for ERK1/2, MITF, and CREB phosphorylation

  • RNA-seq or qPCR for target gene expression changes

  • Measurement of melanin production in melanocyte cultures

Based on studies of MC1R signaling in other species, researchers should employ both gain-of-function and loss-of-function approaches to comprehensively characterize the signaling pathway . When comparing muskox MC1R to other species, attention should be given to potential differences in ligand specificity and downstream effector coupling, which may reflect evolutionary adaptation to specific environmental conditions.

How can researchers effectively design primers for amplification and sequencing of MC1R in genetic studies?

Effective primer design for MC1R amplification requires careful consideration of several factors:

Primer Design Considerations:

ParameterRecommendationRationale
Primer Length18-25 nucleotidesBalances specificity with annealing efficiency
GC Content40-60%Ensures stable annealing and appropriate Tm
3' End StabilityAvoid >2 G or C residuesPrevents non-specific priming
Amplicon Size200-300 bp for degraded DNAOptimal for samples with fragmented DNA (e.g., feathers)
Target RegionCentral portion with highest variationCritical for polymorphism detection

For studying MC1R in species like muskox, researchers should note that DNA obtained from non-invasive samples such as feathers or hair often yields fragmented DNA. In such cases, designing multiple primer pairs that amplify overlapping fragments of 200-300 bp has proven successful .

When designing experimental protocols, it's advisable to include:

  • Positive controls from well-characterized species

  • Nested PCR approaches for low-quality samples

  • Sequence verification through bidirectional sequencing

  • Phylogenetic comparison with related species to confirm specificity

For regions containing high GC content, the addition of DMSO (5-10%) or betaine (1-2M) to PCR reactions can improve amplification efficiency and specificity.

How do evolutionary selection pressures on MC1R differ between muskox and other mammalian lineages?

Evolutionary analysis of MC1R reveals distinct selection patterns across mammalian lineages, with notable differences between muskox and other mammals:

Comparative Selection Pressure Analysis:

LineagedN/dS Ratio (ω)Selection PatternLikely Evolutionary Driver
Muridae (Mus)0.19Strong purifying selectionFunctional constraints on coat color variation
Mustelidae0.35-1.02*Variable selectionWeaker functional constraints, codon usage bias
Ovibos moschatusNot directly reportedLikely purifying selectionArctic adaptation, limited color polymorphism

*Note: When analyzed with equal codon frequencies versus empirical codon frequencies

The dN/dS ratio (ω) for MC1R in Mus species was estimated at 0.19, indicating strong purifying selection, while mustelids showed higher values (0.35 with empirical codon frequencies) . This suggests stronger functional constraints on MC1R evolution in rodents compared to mustelids. Notably, when equal codon frequencies were used in the analysis, the ω value for mustelids dramatically increased to 1.02, revealing the significant impact of codon usage bias on selection analysis .

For muskox, while direct selection analyses were not provided in the search results, the species' limited coat color variation and adaptation to Arctic environments suggest strong purifying selection similar to other Arctic mammals. Researchers investigating MC1R evolution should consider both coding sequence changes and regulatory mechanisms, as accelerated rates of amino acid replacement observed in some lineages may be associated with ecological niche shifting rather than relaxed selection .

What methodological approaches are most effective for analyzing MC1R evolutionary patterns across species?

Rigorous evolutionary analysis of MC1R requires a comprehensive methodological framework:

Recommended Analytical Approaches:

  • Sequence Data Collection and Alignment:

    • Obtain complete coding sequences from diverse taxonomic groups

    • Use codon-aware alignment software (e.g., MACSE, TranslatorX)

    • Manually verify alignments, particularly at indel boundaries

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios using likelihood-based methods (PAML, HyPhy)

    • Implement both site-specific and branch-specific models

    • Compare one-ratio, free-ratio, and branch-site models for comprehensive assessment

  • Codon Bias Analysis:

    • Calculate codon adaptation index (CAI) and effective number of codons (ENC)

    • Run selection analyses with both empirical and equal codon frequencies

    • Compare results to identify potential codon usage bias effects

  • Statistical Testing:

    • Use likelihood ratio tests to compare nested models

    • Implement Hudson-Kreitman-Aguadé (HKA) test with appropriate outgroups

    • Conduct 10,000+ simulations for robust coalescent framework testing

Research has demonstrated that selection analyses should account for codon usage bias, as dramatic differences in dN/dS ratios were observed in mustelids when analyzed with different codon frequency models . For cross-species comparisons involving muskox, researchers should incorporate both closely related species (other Bovidae) and more distant mammalian groups to identify lineage-specific patterns of selection.

Beyond pigmentation, what other physiological roles does MC1R play that might be relevant to muskox biology?

MC1R has several functions beyond pigmentation that may be particularly relevant to muskox biology:

Non-Pigmentation Functions of MC1R:

  • Anti-inflammatory Activity:

    • MC1R signaling reduces pro-inflammatory cytokine production

    • Suppresses NF-κB activation in response to inflammatory stimuli

    • May contribute to immune homeostasis in skin and other tissues

  • Anti-fungal Response:

    • MC1R participates in defense against fungal pathogens

    • Studies in Candida albicans models showed that siRNA knockdown of MC1R almost completely prevented anti-fungal responses

    • Could be particularly relevant for Arctic mammals facing altered pathogen pressures due to climate change

  • Infection Resistance:

    • One MC1R variant (MC1R R163Q, rs885479) is associated with reduced risk of developing complicated sepsis during hospitalization

    • May influence innate immune responses to bacterial pathogens

    • Potentially important for population resilience in the face of emerging diseases

  • DNA Repair and Antioxidant Defense:

    • MC1R signaling stimulates antioxidant and DNA repair pathways

    • Provides protection against UV-induced DNA damage

    • May be especially important in high-UV Arctic environments with snow reflectance

For muskox specifically, MC1R's role in infection resistance could be particularly significant given the recent identification of Erysipelothrix rhusiopathiae infections in North American muskox populations that have experienced high mortality rates . Research on muskox MC1R could reveal population-specific adaptations in immune function that influence susceptibility to emerging pathogens.

How do MC1R signaling pathways interact with environmental stressors in Arctic species?

MC1R signaling in Arctic species like muskox likely shows specialized adaptations to environmental stressors:

Environmental Stress Response Mechanisms:

  • UV Radiation Exposure:

    • MC1R activation upregulates melanogenesis for photoprotection

    • Stimulates nucleotide excision repair pathways to address UV-induced DNA damage

    • Enhances antioxidant defenses against reactive oxygen species generated by UV exposure

  • Thermal Adaptation:

    • Potential role in seasonal coat color changes to regulate heat absorption

    • May influence thermoregulatory responses through interaction with other melanocortin receptors

    • Coat color adaptation balances UV protection with thermal regulation requirements

  • Immune Challenge Response:

    • MC1R signaling modulates inflammatory responses to microbial challenges

    • Anti-inflammatory properties may prevent excessive immune activation

    • Potential role in adaptation to changing pathogen dynamics in warming Arctic environments

  • Stress Hormone Interaction:

    • Cross-talk between MC1R and hypothalamic-pituitary-adrenal axis

    • Potential integration of stress signals with pigmentation and immune responses

    • Seasonal variation in response sensitivity

For muskox research, investigation of MC1R variants across populations experiencing different environmental stressors could reveal adaptive genetic mechanisms. Particularly interesting would be comparative studies between island populations and mainland populations that experience different pathogen pressures, as suggested by seroprevalence studies of E. rhusiopathiae in various muskox populations .

What is the current evidence for MC1R's role in cancer pathways independent of pigmentation effects?

MC1R influences cancer pathways through multiple mechanisms beyond its role in pigmentation:

MC1R-Associated Cancer Pathways:

  • DNA Repair Enhancement:

    • MC1R activation promotes nucleotide excision repair pathways

    • Stimulates base excision repair mechanisms

    • Enhances cell survival following UV-induced DNA damage

  • Antioxidant Defense:

    • Upregulates cellular antioxidant systems

    • Reduces oxidative stress-induced mutations

    • Protects against mitochondrial dysfunction

  • Cell Cycle Regulation:

    • Influences cell cycle progression and checkpoint activation

    • Modulates p53-dependent pathways

    • Affects cellular senescence mechanisms

Evidence indicates that specific MC1R variants are associated with increased risk of nonmelanoma skin cancers independent of their effects on pigmentation . Studies have found that even in heterozygous individuals, certain MC1R variants serve as risk factors for basal cell carcinoma and squamous cell carcinoma . This suggests that MC1R's cancer-related functions extend beyond simply determining pigmentation levels.

For comparative research using muskox MC1R, investigators should consider:

  • Functional conservation of cancer-protective domains across species

  • Potential adaptive mutations in Arctic species exposed to high UV environments

  • Comparative signaling pathway analysis between species with different cancer susceptibilities

How might MC1R variants influence susceptibility to infectious diseases in muskox populations?

MC1R variants may significantly impact infectious disease susceptibility in muskox populations:

Infection Susceptibility Mechanisms:

  • Inflammatory Response Modulation:

    • MC1R signaling reduces pro-inflammatory cytokine production

    • Variants may alter the balance between protective immunity and immunopathology

    • Could influence disease severity rather than initial infection rates

  • Pathogen-Specific Defense Mechanisms:

    • MC1R involvement in anti-fungal responses suggests broader antimicrobial functions

    • May participate in innate immune recognition of specific pathogens

    • Potential role in barrier defense at epithelial surfaces

  • Population-Level Considerations:

    • Geographic distribution of MC1R variants may correlate with historical pathogen pressures

    • Selection for specific variants could reflect regional disease challenges

    • Frequency of protective alleles might predict population resilience

The involvement of MC1R in a rat model of Candida albicans infection demonstrates its importance in anti-fungal responses . Additionally, the association of an MC1R variant (MC1R R163Q) with reduced risk of complicated sepsis suggests a role in bacterial infection outcomes . For muskox populations experiencing emerging infectious diseases like Erysipelothrix rhusiopathiae, MC1R variation could potentially influence population susceptibility and recovery .

Research opportunities include:

  • Genotyping MC1R across muskox populations with different disease histories

  • Correlating variant frequencies with seroprevalence data for key pathogens

  • Functional testing of population-specific variants in immune response assays

What cell-based systems are most appropriate for studying recombinant muskox MC1R function and signaling?

Selecting optimal cell systems for muskox MC1R research requires careful consideration of experimental objectives:

Recommended Cell Systems:

Cell SystemAdvantagesApplicationsConsiderations
HEK293Low endogenous MC1R, high transfection efficiencyReceptor binding, cAMP signaling, mutagenesisLacks melanocyte-specific machinery
B16 melanomaContains melanogenic enzymes, physiologically relevantMelanin production, gene expression, pathway crosstalkEndogenous MC1R expression may complicate analysis
Primary muskox melanocytesMost physiologically relevantSpecies-specific signaling, environmental response studiesDifficult to obtain, limited lifespan
CRISPR-engineered cellsPrecise genetic control, isogenic comparisonsVariant functional analysis, signaling pathway dissectionRequires advanced gene editing expertise

For functional characterization of muskox MC1R, heterologous expression systems like HEK293 cells provide a clean background for initial signaling studies, while melanocyte lines enable investigation of downstream melanogenic responses. Based on methodologies used in MC1R research across species, a complementary approach using multiple cell systems is recommended .

Advanced applications should consider:

  • Generating stable cell lines expressing different natural MC1R variants

  • Implementing inducible expression systems for temporal control

  • Using fluorescent protein fusions to monitor receptor trafficking

  • Developing co-culture systems to examine cell-cell communication mediated by MC1R signaling

What are the most promising approaches for investigating MC1R's role in adaptation to Arctic environments?

Investigating MC1R's role in Arctic adaptation requires integrative approaches spanning multiple disciplines:

Research Strategy Framework:

  • Population Genomics:

    • Sequence MC1R across Arctic mammal species including muskox

    • Identify convergent amino acid substitutions in Arctic-adapted species

    • Apply population genetic tests for selective sweeps around MC1R locus

    • Compare with closely related non-Arctic species to identify Arctic-specific patterns

  • Functional Genomics:

    • Conduct site-directed mutagenesis of identified variants

    • Measure receptor function at different temperatures (cold adaptation)

    • Assess UV response pathways in cells expressing Arctic MC1R variants

    • Examine regulation under seasonal photoperiod conditions

  • Ecological Correlations:

    • Map MC1R variant distribution against environmental variables

    • Correlate with historical climate records and predicted future scenarios

    • Assess relationship with pathogen prevalence data

    • Integrate with phenotypic data on coat color and molting patterns

  • Comparative Transcriptomics:

    • Analyze gene expression networks centered on MC1R

    • Compare seasonal expression patterns between Arctic and temperate species

    • Identify environment-responsive regulatory mechanisms

    • Examine single-cell expression patterns in relevant tissues

Methodologically, researchers should employ techniques from recent studies that have identified differential clustering of melanocytes based on MC1R signaling status . Multi-omics approaches that integrate genomic, transcriptomic, and proteomic data will provide the most comprehensive understanding of MC1R's role in Arctic adaptation.

What quality control measures are essential when working with recombinant muskox MC1R protein?

Comprehensive quality control is critical for research reliability with recombinant muskox MC1R:

Essential Quality Control Procedures:

  • Purity Assessment:

    • SDS-PAGE with Coomassie staining (>90% purity recommended)

    • Western blot confirmation with MC1R-specific antibodies

    • Mass spectrometry verification of intact protein mass

  • Functional Validation:

    • Ligand binding assays with α-MSH and other melanocortins

    • cAMP accumulation in response to agonist stimulation

    • Confirmation of expected post-translational modifications

  • Structural Integrity:

    • Circular dichroism to verify secondary structure elements

    • Fluorescence spectroscopy to assess tertiary folding

    • Size exclusion chromatography to detect aggregation

  • Storage Stability Testing:

    • Activity retention after storage at recommended conditions

    • Freeze-thaw stability assessment

    • Temperature sensitivity analysis

  • Endotoxin Testing:

    • Limulus amebocyte lysate (LAL) assay (<1 EU/mg protein)

    • Verification that endotoxin levels don't interfere with biological assays

For recombinant muskox MC1R, researchers should particularly verify correct protein folding, as the native structure includes seven-transmembrane domains characteristic of G protein-coupled receptors . When planning experiments, include appropriate positive controls such as well-characterized MC1R proteins from other species and negative controls lacking MC1R expression to ensure assay specificity.

How can researchers effectively design experiments to compare MC1R function across different mammalian species?

Cross-species functional comparison of MC1R requires careful experimental design:

Experimental Design Framework:

  • Sequence-Based Selection of Test Species:

    • Include species representing diverse evolutionary lineages

    • Select species with known functional variations in MC1R

    • Include Arctic specialists (muskox) and generalists for environmental adaptation comparison

    • Consider species with different coat color polymorphism frequencies

  • Standardized Expression Systems:

    • Express all species' MC1R variants in the same cell background

    • Use identical promoters and expression vectors

    • Verify equivalent protein expression levels by Western blot

    • Control for membrane localization differences

  • Comparative Functional Assays:

    • Dose-response curves for standard melanocortin ligands

    • Competition binding with species-specific antagonists

    • cAMP accumulation measured under identical conditions

    • Calcium mobilization as secondary messenger readout

  • Environmental Response Testing:

    • Assess function across temperature gradients (4-37°C)

    • Examine pH sensitivity differences

    • Test UV response pathway activation

    • Evaluate oxidative stress resistance

  • Statistical Analysis:

    • Use hierarchical linear modeling to account for species relationships

    • Apply phylogenetic comparative methods to control for evolutionary distance

    • Calculate effect sizes to quantify functional differences

    • Implement bootstrap resampling for robust confidence intervals

When interpreting results, researchers should consider both the coding sequence differences and the codon usage bias patterns that may reflect different selection pressures across lineages . The experimental design should account for differences in selective constraints observed between taxonomic groups, such as those documented between Mus and mustelid lineages .

What are the most promising research directions for understanding MC1R's role in muskox adaptation to changing Arctic conditions?

Several high-potential research directions emerge for investigating MC1R in muskox adaptation:

Priority Research Directions:

  • Climate Change Response:

    • Investigate MC1R regulation under simulated future climate scenarios

    • Examine melanin production changes in response to altered UV exposure

    • Assess potential mismatch between coat color and seasonal snow cover

    • Model selection pressures under different warming scenarios

  • Emerging Disease Interactions:

    • Explore links between MC1R variants and susceptibility to Erysipelothrix rhusiopathiae

    • Investigate potential correlation between MC1R genotypes and antibody responses

    • Compare immune modulation by different MC1R variants in controlled conditions

    • Assess population distribution of protective MC1R alleles

  • Genomic Integration:

    • Perform whole-genome sequencing to identify MC1R regulatory regions

    • Examine epigenetic regulation of MC1R in different tissues

    • Identify interacting partners in muskox-specific signaling networks

    • Conduct comparative analyses with other Arctic mammals

  • Conservation Applications:

    • Develop MC1R variant panels as markers for population health monitoring

    • Assess genetic diversity in MC1R across fragmented muskox populations

    • Investigate potential genetic rescue strategies for at-risk populations

    • Examine MC1R adaptation in reintroduced populations

The recent discovery of Erysipelothrix rhusiopathiae causing high mortality in Canadian Arctic muskoxen highlights the urgency of understanding genetic factors that may influence disease resistance. MC1R's documented role in anti-inflammatory and anti-fungal processes suggests it could be an important target for research on pathogen resistance in changing Arctic environments.

What technological innovations would advance the study of MC1R in wildlife conservation genomics?

Emerging technologies offer significant opportunities for advancing MC1R research in wildlife conservation:

Technological Innovation Opportunities:

  • Non-invasive Sampling Methods:

    • Development of optimized protocols for MC1R amplification from shed hair and feces

    • Environmental DNA approaches for population-level MC1R variant screening

    • Remote biopsy methods for minimally disruptive sampling

    • Field-deployable genotyping platforms for real-time analysis

  • Advanced Sequencing Approaches:

    • Long-read sequencing to capture complete MC1R haplotypes including regulatory regions

    • Single-cell RNA-seq to characterize MC1R expression in different cell types

    • Targeted amplicon sequencing for high-throughput population screening

    • Nanopore sequencing for field-based genomic analysis

  • Functional Genomics Tools:

    • CRISPR-based systems for modeling muskox MC1R variants in cell culture

    • Organoid development for three-dimensional tissue modeling

    • Multi-omic integration platforms for systems-level analysis

    • High-throughput functional screening of variant libraries

  • Computational Methods:

    • Machine learning approaches to predict functional consequences of MC1R variants

    • Population modeling incorporating MC1R genotypes and climate projections

    • Network analysis tools for mapping MC1R interactions with other pathways

    • Phylogenomic methods for detecting convergent evolution in Arctic mammals

For wildlife conservation genomics, methodological improvements that enable analysis of low-quality DNA samples are particularly valuable, as demonstrated by studies that successfully amplified MC1R from non-molting feathers by designing primers for smaller fragments (200-300 bp) . Similarly, statistical approaches like the mixture distribution model used to determine cut-offs for serological tests could be adapted for improving genotype calling from marginal samples.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.