Recombinant Oxytricha trifallax Macronuclear solute carrier homolog CR-MSC

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain stability for up to 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize its implementation.
Synonyms
Macronuclear solute carrier homolog CR-MSC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Oxytricha trifallax (Sterkiella histriomuscorum)
Target Protein Sequence
MPTQMEVEYWRRRYQRMNYERFAAANVIALITHAATQPLDMVRIRSQMLQEGKTFSGLGY QKGWYPFQIMEEIYAAGGGLRKFYSAFDTFFFRTVGYTTARVTAFGYFYDKVNKDPRRVA RPDFLVAAGVLGGFIAGVVTNPIDIVYNRMQVDELYPQAARRNYSNTVQGLAKVAEEGAL FRGAGANGFKLAAICSSMTNIYDWCKENSYFFFGPHWINRLWGTAVAVAIGTVVSMPFDM IRTRLHTMRPLPNGQMPYNGMFDCFNKIIKYECNSKWMSNFGSFYAGGEAYFLRLFLICY LSQFLVDYYNENYYDQEFWQPQRFHYQSGIDYDIHDPYTDAFNKKLVATYTTAAGGMGAA HPSGKDNLAII
Uniprot No.

Target Background

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Oxytricha trifallax Macronuclear Solute Carrier Homolog CR-MSC?

Oxytricha trifallax Macronuclear Solute Carrier Homolog CR-MSC (UniProt ID: Q27151) is a protein encoded by the macronuclear genome of the ciliate Oxytricha trifallax (also known as Sterkiella histriomuscorum). This protein belongs to the solute carrier family, which typically functions in the transport of various substances across cellular membranes. The protein consists of 371 amino acids and is part of the unique and complex eukaryotic genome architecture of O. trifallax . Unlike typical eukaryotic genomes, the O. trifallax macronuclear genome is highly fragmented into thousands of small chromosomes, with most encoding single genes, making this organism and its proteins particularly interesting for evolutionary and functional studies .

How is Recombinant CR-MSC protein produced for research applications?

Recombinant CR-MSC protein is produced using a heterologous expression system in E. coli. The general methodology involves:

  • Gene Cloning: The coding sequence for the CR-MSC protein (amino acids 1-371) is cloned into an expression vector that includes an N-terminal His-tag for purification purposes.

  • Transformation and Expression: The expression construct is transformed into E. coli cells, which are then cultured under optimized conditions to induce protein expression.

  • Protein Purification: The expressed protein is purified using affinity chromatography, typically with nickel or cobalt resins that bind the His-tag.

  • Quality Control: The purified protein undergoes quality assessment through SDS-PAGE to confirm a purity greater than 90% .

  • Formulation and Storage: The purified protein is formulated in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 and lyophilized for stability and long-term storage .

This recombinant approach allows researchers to obtain significant quantities of pure protein for structural, functional, and interaction studies that would otherwise be challenging due to the limited biomass available from native Oxytricha trifallax cultures.

What are the optimal storage and handling conditions for Recombinant CR-MSC protein?

For optimal stability and activity, Recombinant CR-MSC protein should be handled according to these guidelines:

  • Long-term Storage: Store the lyophilized powder at -20°C to -80°C upon receipt .

  • Reconstitution: Before opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Post-Reconstitution Storage:

    • Add glycerol to a final concentration of 5-50% (recommended 50%) and store aliquots at -20°C to -80°C for long-term use .

    • For short-term use, working aliquots can be stored at 4°C for up to one week .

  • Avoid Freeze-Thaw Cycles: Repeated freezing and thawing significantly reduces protein activity and should be avoided .

  • Buffer Compatibility: When designing experiments, consider that the protein is formulated in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which may affect downstream applications .

Proper storage and handling are crucial for maintaining the structural integrity and functional activity of the protein for research applications.

What experimental techniques are most suitable for studying CR-MSC function and interactions?

Several experimental approaches are particularly effective for investigating CR-MSC function and interactions:

  • Transport Assays:

    • Liposome reconstitution assays to study transport kinetics

    • Membrane vesicle uptake assays using radioisotope or fluorescently labeled substrates

    • Electrophysiological techniques (patch clamp) to measure transport-associated currents

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with antibodies against the His-tag

    • Proximity labeling techniques (BioID, APEX)

    • Surface plasmon resonance for quantitative binding kinetics

    • Yeast two-hybrid screening to identify novel interactors

  • Structural Biology Approaches:

    • X-ray crystallography of purified protein

    • Cryo-electron microscopy for structural determination

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • Functional Genomics:

    • Heterologous expression in model organisms lacking endogenous transporters

    • CRISPR-Cas9 mutagenesis to create functional variants

    • Complementation assays in transport-deficient cell lines

  • Biophysical Characterization:

    • Circular dichroism to assess secondary structure stability

    • Thermal shift assays to evaluate ligand binding

    • Microscale thermophoresis for detecting molecular interactions

When designing these experiments, researchers should consider the potential interference of the N-terminal His-tag with protein function, possibly requiring control experiments with tag-cleaved protein variants.

How does the unusual genomic architecture of Oxytricha trifallax influence CR-MSC expression and function?

The extraordinary genomic architecture of Oxytricha trifallax creates unique considerations for CR-MSC research:

  • Single-Gene Chromosomes: The CR-MSC gene resides on one of the approximately 16,000 tiny chromosomes in the macronuclear genome, most of which encode single genes . This arrangement results in independent regulation and amplification of the CR-MSC gene, potentially allowing for more precise control of expression levels.

  • Differential Amplification: Macronuclear chromosomes in O. trifallax are differentially amplified to a few thousand copies each . Research indicates that this differential amplification contributes to gene expression regulation, though transcript levels are not solely determined by copy number variation .

  • Telomere Dynamics: The CR-MSC gene-containing chromosome is capped by telomeres, as O. trifallax maintains tens of millions of telomeres per cell . This telomere proximity may affect chromatin structure and transcriptional activity of the CR-MSC gene.

  • Alternative Fragmentation: The O. trifallax genome exhibits frequent alternative fragmentation patterns, potentially creating chromosome isoforms that share sequence but differ in their boundaries . This phenomenon could generate CR-MSC protein variants with altered regulatory elements or expression patterns.

  • Post-Zygotic Development: During sexual reproduction, approximately 96% of the micronuclear genome complexity is eliminated to form the macronucleus . This massive genome rearrangement process may influence the evolutionary trajectory of the CR-MSC gene compared to homologs in organisms with conventional genome architecture.

These unique genomic features create both challenges and opportunities for researchers studying CR-MSC expression, regulation, and evolution in its native context.

What are the challenges in designing expression systems for functional studies of CR-MSC?

Researchers face several challenges when designing expression systems for CR-MSC functional studies:

  • Codon Optimization:

    • O. trifallax has different codon usage preferences compared to common laboratory organisms

    • Codon optimization is necessary for efficient expression in heterologous systems like E. coli

    • Synthetized genes should be designed with codon adaptation indices appropriate for the expression host

  • Post-Translational Modifications:

    • Potential ciliate-specific modifications may be absent in prokaryotic systems

    • Eukaryotic expression systems (yeast, insect cells) may better preserve functional modifications

    • Comparative analysis of protein produced in different systems may be necessary

  • Membrane Protein Expression Challenges:

    • As a solute carrier, CR-MSC likely contains multiple transmembrane domains

    • Expression may cause toxicity to host cells due to membrane disruption

    • Inducible expression systems with tight regulation are recommended

    • Fusion partners like GFP can monitor localization but may affect function

  • Purification Strategy Optimization:

    • Detergent selection is critical for extracting membrane proteins without denaturation

    • A purification table comparing different approaches is provided below:

Purification MethodAdvantagesDisadvantagesRecommended Detergents
IMAC (His-tag)High specificity, single-stepTag may affect functionDDM, LMNG, Triton X-100
Size ExclusionGood for oligomeric state analysisLow resolutionDigitonin, GDN
Ion ExchangeNo tag requiredpH sensitivityCHAPS, Fos-choline
Affinity ChromatographyHigh purityRequires specific ligandsOG, LDAO
  • Functional Reconstitution:

    • Lipid composition affects transport activity

    • Reconstitution into liposomes or nanodiscs is often necessary for functional assays

    • Protein-to-lipid ratios require optimization for each experimental system

Addressing these challenges requires systematic optimization and validation to ensure that the recombinant CR-MSC protein faithfully represents the native protein's functional properties.

How can site-directed mutagenesis be used to identify critical functional residues in CR-MSC?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationships in CR-MSC. A comprehensive mutagenesis strategy should include:

  • Targeted Residue Selection:

    • Conserved amino acids identified through multiple sequence alignment with other solute carrier proteins

    • Charged residues within predicted transmembrane domains that may form part of the substrate translocation pathway

    • Residues in predicted substrate binding pockets based on homology modeling

    • Key positions at the interfaces between protein domains that may facilitate conformational changes

  • Systematic Mutation Categories:

    • Alanine scanning: replacing selected residues with alanine to remove side chain interactions

    • Conservative substitutions: maintaining charge or polarity while altering size (e.g., Asp→Glu)

    • Non-conservative substitutions: changing fundamental properties (e.g., Lys→Glu for charge reversal)

    • Cysteine substitutions: enabling subsequent labeling for accessibility studies

  • Functional Assays for Mutant Characterization:

    • Transport activity measurements using reconstituted proteoliposomes

    • Binding affinity determinations using isothermal titration calorimetry

    • Conformational dynamics assessment using hydrogen-deuterium exchange mass spectrometry

    • Protein stability analysis using thermal shift assays

  • Data Analysis Framework:

Mutation CategoryExpected Effect if Residue is CriticalControl Experiments
Substrate BindingIncreased Km, unchanged VmaxTest multiple substrates
Channel FormationDecreased Vmax, unchanged KmMeasure at various membrane potentials
Conformational ChangeAltered transport kineticsTest temperature dependence
Protein StabilityDecreased expression/activityVerify proper folding by CD spectroscopy
  • Integration with Structural Information:

    • Map mutations onto 3D models to visualize spatial relationships

    • Correlate functional defects with structural perturbations

    • Use data to refine computational models of transport mechanism

This systematic approach enables researchers to develop a comprehensive functional map of CR-MSC, identifying residues essential for substrate recognition, binding, transport, and regulation.

What insights can comparative genomics provide about the evolution of CR-MSC in ciliates and other organisms?

Comparative genomics offers valuable insights into CR-MSC evolution across diverse organisms:

  • Evolutionary Origin and Divergence:

    • Phylogenetic analysis suggests CR-MSC belongs to an ancient solute carrier family that likely predates the divergence of major eukaryotic lineages

    • Sequence comparison with homologs from other ciliates (Tetrahymena, Paramecium) reveals lineage-specific adaptations

    • Domain architecture analysis can identify conserved functional modules versus rapidly evolving regions

  • Adaptation to Genomic Architecture:

    • The fragmented macronuclear genome of Oxytricha trifallax represents a unique evolutionary context for CR-MSC

    • Unlike related proteins in organisms with conventional genomes, CR-MSC has evolved under selective pressures associated with genome rearrangement during macronuclear development

    • Comparative analysis of CR-MSC homologs in ciliates with different degrees of genome fragmentation (O. trifallax vs. Tetrahymena) can reveal how genomic architecture influences protein evolution

  • Selection Pressure Analysis:

    • dN/dS ratio calculations across homologs can identify regions under purifying, neutral, or positive selection

    • Transmembrane domains typically show stronger conservation than loop regions

    • Substrate binding sites may show signatures of adaptive evolution in response to environmental pressures

  • Gene Duplication and Specialization:

    • Many solute carrier families underwent expansion through gene duplication events

    • Analysis of paralogs can reveal subfunctionalization or neofunctionalization patterns

    • The high nucleotide diversity observed in O. trifallax (SNP heterozygosity ~4.0%) provides an opportunity to study recent evolutionary changes

  • Horizontal Gene Transfer Assessment:

    • Unusually high sequence similarity to bacterial transporters could indicate horizontal gene transfer events

    • Intron-exon structure analysis can help distinguish between vertical inheritance and horizontal acquisition

    • The presence of domesticated transposases in the O. trifallax genome suggests mechanisms for potential gene capture

This evolutionary context provides a deeper understanding of CR-MSC function and may reveal adaptations that could be exploited in biotechnological applications or as models for understanding solute carrier evolution more broadly.

What methodological approaches can overcome the challenges of studying CR-MSC in its native cellular context?

Studying CR-MSC in its native Oxytricha trifallax cellular environment presents unique challenges that require specialized methodological approaches:

  • Ciliate-Specific Culturing Optimization:

    • Develop defined media formulations that support consistent growth while enabling experimental manipulations

    • Establish synchronization protocols to study cell cycle-dependent regulation of CR-MSC

    • Optimize transfection methods for introducing genetic constructs into O. trifallax

  • Genome Editing in Oxytricha trifallax:

    • Adapt CRISPR-Cas9 systems to target the unusual macronuclear genome structure

    • Design strategies that account for the thousands of chromosome copies in the macronucleus

    • Implement selection markers compatible with ciliate biology for isolating edited cells

  • Live Cell Imaging Approaches:

    • Develop fluorescent protein tags optimized for ciliate codon usage and expression

    • Establish cell immobilization techniques that preserve normal physiology

    • Implement advanced microscopy methods (TIRF, confocal, super-resolution) to visualize CR-MSC localization and dynamics

  • Functional Assays in Native Context:

    • Design substrate analogs that can penetrate the complex ciliate cellular architecture

    • Develop cell-based transport assays with quantifiable readouts

    • Implement electrophysiological approaches adapted for ciliate cells

  • Integrated Multi-Omics Approach:

    • Combine transcriptomics, proteomics, and metabolomics to understand CR-MSC in its broader cellular context

    • Protocol outline for a comprehensive approach:

StageTechniqueSpecific Adaptation for Oxytricha
1. PreparationCell fractionationSeparate macronucleus from other cellular components
2. TranscriptomicsRNA-seqAccount for non-coding transcripts from the fragmented genome
3. ProteomicsMass spectrometryOptimize protein extraction from ciliate membranes
4. InteractomicsProximity labelingUse BioID or APEX2 fusions to CR-MSC
5. MetabolomicsTargeted metabolite analysisFocus on potential transport substrates
6. Data integrationNetwork analysisIdentify functional modules involving CR-MSC
  • Developmental Biology Approaches:

    • Study CR-MSC during sexual reproduction and macronuclear development

    • Track the fate of the CR-MSC gene during the extensive genome rearrangements

    • Investigate potential roles in the unique nuclear dimorphism of ciliates

These methodological approaches collectively provide a framework for understanding CR-MSC function in its native context, despite the challenges posed by Oxytricha trifallax's unusual biology and genomic architecture.

What are the future research directions for understanding CR-MSC function in the context of Oxytricha trifallax biology?

Future research on CR-MSC holds significant potential for advancing our understanding of both solute carrier proteins and the unique biology of Oxytricha trifallax. Key research directions include:

  • Substrate Identification and Transport Mechanism:

    • Systematic screening to identify the natural substrates of CR-MSC

    • Characterization of transport kinetics and electrogenicity

    • Development of specific inhibitors as research tools

  • Regulatory Network Mapping:

    • Investigation of transcriptional and post-translational regulation

    • Identification of protein interaction partners in different cellular contexts

    • Analysis of CR-MSC expression during different life cycle stages

  • Evolutionary Genomics:

    • Comprehensive comparative analysis across ciliate species

    • Investigation of how genome fragmentation influences protein evolution

    • Examination of the relationship between CR-MSC and related transporters in other organisms

  • Technological Development:

    • Creation of CR-MSC-specific antibodies and nanobodies

    • Development of ciliate-optimized gene editing systems

    • Establishment of high-throughput functional assays

  • Structural Biology Integration:

    • Determination of high-resolution structures in different conformational states

    • Computational modeling of substrate translocation pathways

    • Structure-guided design of functional probes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.