Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Discovery and Function

The AaeA subunit, along with AaeB, forms the AaeAB efflux pump, which belongs to the Resistance-Nodulation-Division (RND) superfamily of transporters . This pump is induced in E. coli upon exposure to p-hydroxybenzoic acid (pHBA) . The AaeAB pump exports aromatic carboxylic acids, suggesting a role in maintaining cellular homeostasis by removing potentially toxic metabolites . The genes encoding AaeA and AaeB were initially named yhcQ and yhcP, respectively, but were later renamed to reflect their function in aromatic carboxylic acid efflux . The AaeAB efflux system may act as a "metabolic relief valve" to mitigate the toxic effects of metabolic imbalances .

Structure and Mechanism

Proteins are comprised of amino acid chains, where the sequence and interactions between amino acids dictate the protein's three-dimensional structure and function . Efflux pumps like AaeAB, which are found in the cell membrane, contain hydrophobic regions that allow them to interact with the lipid bilayer .

Although the specific structure of AaeA has not been resolved, the structure of other efflux pump subunits provides insight into its potential mechanism. For example, the structure of the insecticidal protein GNIP1Aa from Chromobacterium piscinae reveals two distinct domains: a MACPF (membrane attack complex/PerForin) domain and a novel β-tripod domain . The MACPF domain is important for oligomerization and transmembrane pore formation, while the β-tripod domain defines the target specificity .

Regulation

The expression of the AaeAB efflux pump is tightly regulated, indicating its importance in E. coli metabolism . In Acinetobacter baumannii, the AdeABC efflux pump is regulated by the two-component system (TCS) AdeRS . The AdeS protein is a sensor histidine kinase (HK) that detects environmental stimuli, and the AdeR protein is a DNA-binding response regulator (RR) that induces changes in gene expression . Similarly, the MacAB-TolC efflux pump is regulated by the PhoPQ TCS, which governs virulence and resistance to antimicrobial peptides .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
aaeA; Z4600; ECs4114; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMSR EEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGST AVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTRD DKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFRK MAHRLREFG
Uniprot No.

Target Background

Function

Forms an efflux pump in conjunction with AaeB.

Database Links

KEGG: ece:Z4600

STRING: 155864.Z4600

Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the p-hydroxybenzoic acid efflux pump subunit AaeA and what is its function in bacterial systems?

AaeA (formerly known as YhcQ) is a membrane fusion protein that functions as a critical component of the AaeAB efflux pump system in Escherichia coli. This protein works in conjunction with AaeB (formerly YhcP) to form a functional efflux pump that specifically transports aromatic carboxylic acids, including p-hydroxybenzoic acid (pHBA), out of the bacterial cell .

The AaeAB system serves as a "metabolic relief valve" that helps alleviate the toxic effects of imbalanced metabolism by removing potentially harmful aromatic carboxylic acids from the cell . Expression studies have demonstrated that both AaeA and AaeB are necessary and sufficient for suppression of pHBA hypersensitivity in E. coli strains with mutations in the regulatory protein AaeR (formerly YhcS) .

How is the expression of aaeA regulated at the molecular level?

The expression of aaeA is tightly regulated by several molecular mechanisms:

  • Transcriptional regulation: The aaeA gene is regulated by AaeR, a protein of the LysR transcriptional regulator family . AaeR binds to specific DNA sequences in the promoter region of the aaeXAB operon, controlling transcription in response to aromatic carboxylic acids.

  • Induction factors: Several aromatic carboxylic acid compounds serve as inducers of aaeA expression. Treatment of E. coli with p-hydroxybenzoic acid results in significant upregulation of the aaeA gene .

  • Operon structure: The aaeA gene is part of an operon that includes aaeX (formerly yhcR), a small protein without a known function, and aaeB (formerly yhcP), which encodes the membrane transporter component of the efflux pump .

The regulatory protein AaeR is encoded by a gene (formerly yhcS) that is divergently transcribed from the aaeXAB operon, suggesting a coordinated regulation mechanism .

What experimental approaches can reliably detect AaeA expression levels in bacterial cultures?

Several methodological approaches can be employed to quantify AaeA expression levels:

  • Quantitative RT-PCR: This technique allows precise measurement of aaeA mRNA levels. Primers should be designed to specifically amplify the aaeA gene sequence. Expression can be normalized to housekeeping genes such as 16S rRNA or rpoD.

  • Western blotting: Using antibodies specific to AaeA, protein expression levels can be quantified. This approach requires development or acquisition of AaeA-specific antibodies.

  • Reporter gene assays: The aaeA promoter can be fused to reporter genes such as lacZ or GFP to monitor expression levels under different conditions.

  • RNA-seq analysis: This approach provides a comprehensive view of gene expression and can detect changes in aaeA transcript levels in response to different treatments.

For accurate quantification, expression data should be analyzed using appropriate statistical methods, including techniques for comparing percentage changes between experimental conditions . When analyzing time-series expression data, regression-based approaches may provide more reliable estimates of changes than endpoint measurements .

What are the optimal expression systems and conditions for producing recombinant AaeA protein?

When designing expression systems for recombinant AaeA production, researchers should consider the following factors:

  • Expression host selection: For membrane-associated proteins like AaeA, E. coli expression systems are often appropriate, particularly strains optimized for membrane protein expression such as C41(DE3) or C43(DE3).

  • Vector design: Consider using vectors with tunable promoters (e.g., pBAD series) to control expression levels and prevent toxicity. Including fusion tags that aid in purification and solubility (e.g., His-tag, MBP, or SUMO) can improve yield.

  • Induction conditions: Optimize temperature, inducer concentration, and induction time. For membrane proteins, lower temperatures (16-25°C) and longer induction times often improve proper folding.

  • Media composition: Supplementing growth media with aromatic carboxylic acids at sub-inhibitory concentrations may enhance expression by activating native regulatory pathways .

  • Extraction methods: Gentle detergent solubilization is typically required for membrane-associated proteins like AaeA. Screen multiple detergents (e.g., DDM, LDAO, or Triton X-100) to identify optimal extraction conditions.

When evaluating expression systems, researchers should conduct systematic optimization experiments, varying each parameter independently while monitoring protein yield and activity.

How can researchers assess the functionality of recombinant AaeA in experimental systems?

Assessing recombinant AaeA functionality requires methodological approaches that verify both structural integrity and biological activity:

  • Complementation assays: Introduce recombinant AaeA into aaeA-mutant strains and measure restoration of p-hydroxybenzoic acid resistance. A functional AaeA protein should suppress the hypersensitivity phenotype when co-expressed with AaeB .

  • Substrate transport assays: Measure the ability of cells expressing recombinant AaeA (in conjunction with AaeB) to export radioactively or fluorescently labeled aromatic carboxylic acids.

  • Protein-protein interaction assays: Verify interaction between AaeA and AaeB using techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or fluorescence resonance energy transfer (FRET).

  • Structural characterization: Circular dichroism spectroscopy can assess secondary structure integrity, while thermal shift assays can evaluate protein stability.

Data from functionality assessments should be analyzed using appropriate statistical methods, accounting for experimental variability and potential contradictions in results using structured contradiction patterns analysis .

What purification strategies yield high-purity, functional recombinant AaeA protein?

Purifying membrane-associated proteins like AaeA requires specialized approaches:

  • Membrane extraction: Use a two-step extraction process:

    • Cell lysis under native conditions (e.g., French press or sonication)

    • Membrane fraction isolation by ultracentrifugation

    • Detergent solubilization of membrane proteins

  • Affinity chromatography: For His-tagged AaeA, use immobilized metal affinity chromatography (IMAC) with careful optimization of imidazole concentrations for binding and elution.

  • Size exclusion chromatography: This step separates properly folded protein from aggregates and removes residual contaminants.

  • Tag removal: If applicable, cleave fusion tags using specific proteases (e.g., TEV or SUMO protease) followed by reverse affinity chromatography.

  • Protein stabilization: Throughout purification, maintain appropriate detergent concentrations above the critical micelle concentration and consider adding stabilizing agents like glycerol or specific lipids.

The purification process should be monitored at each step using SDS-PAGE, Western blotting, and activity assays to ensure retention of protein functionality.

How can structural studies of AaeA contribute to understanding efflux pump mechanisms?

Structural characterization of AaeA provides critical insights into efflux pump function:

  • Crystallography and cryo-EM approaches: These methods can reveal:

    • The three-dimensional structure of AaeA alone and in complex with AaeB

    • Specific domains involved in substrate recognition

    • Conformational changes associated with transport activity

  • Molecular dynamics simulations: Based on structural data, simulations can predict:

    • How AaeA facilitates substrate movement through the efflux system

    • Potential energy barriers in the transport process

    • Effects of mutations on protein dynamics

  • Structure-guided mutagenesis: Targeted mutations can validate structural predictions by:

    • Identifying residues critical for AaeA-AaeB interactions

    • Determining regions involved in substrate specificity

    • Revealing domains important for membrane association

When designing structural studies, researchers should consider multiple experimental approaches to overcome challenges associated with membrane protein crystallization. Expression systems that yield homogeneous, stable protein preparations are essential for successful structural determination.

How do mutations in the aaeA gene affect substrate specificity and transport efficiency?

Investigating the functional consequences of aaeA mutations requires systematic approaches:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through sequence alignment with other membrane fusion proteins

    • Focus on regions predicted to interact with AaeB or substrates

    • Create alanine scanning libraries across functional domains

  • Functional characterization methods:

    • Measure growth inhibition in the presence of various aromatic carboxylic acids

    • Quantify transport kinetics using labeled substrates

    • Assess protein-protein interactions between mutant AaeA and wild-type AaeB

  • Data analysis framework:

    • Compare transport efficiency and specificity across mutants using standardized assays

    • Analyze patterns of cross-resistance to identify substrate recognition determinants

    • Correlate structural features with functional outcomes

When interpreting mutation studies, researchers should apply contradiction analysis methods to resolve potentially conflicting results from different experimental approaches .

How can systems biology approaches integrate AaeA function into broader cellular response networks?

Systems biology offers powerful frameworks for understanding AaeA's role in cellular physiology:

  • Multi-omics integration strategies:

    • Combine transcriptomics, proteomics, and metabolomics data to map cellular responses to aromatic carboxylic acid stress

    • Identify regulatory networks connecting AaeA to other stress response systems

    • Quantify metabolic flux changes in wild-type versus aaeA mutant strains

  • Network analysis approaches:

    • Construct protein-protein interaction networks centered on AaeA and AaeB

    • Identify functional modules associated with aromatic carboxylic acid metabolism

    • Map signal transduction pathways linking environmental sensing to efflux pump expression

  • Computational modeling methods:

    • Develop kinetic models of efflux pump activity

    • Simulate cellular responses to varying levels of aromatic carboxylic acids

    • Predict systemic effects of aaeA mutations or expression changes

Data integration in systems biology studies presents particular challenges. Researchers should apply structured contradiction analysis approaches to identify and resolve inconsistencies between different data types . Boolean minimization techniques can be valuable for handling complex interdependencies in multi-factor datasets .

What strategies can address contradictory results in AaeA functional studies?

Addressing contradictions in experimental results requires systematic approaches:

  • Structured contradiction analysis:

    • Apply formal notation for contradiction patterns using parameters α (number of interdependent items), β (number of contradictory dependencies), and θ (minimum number of Boolean rules)

    • Classify contradictions to identify their underlying patterns

    • Implement assessment frameworks appropriate to the complexity of the experimental system

  • Experimental validation hierarchy:

    • Prioritize in vivo functional assays over in vitro biochemical tests

    • Verify protein-protein interactions using multiple complementary methods

    • Confirm expression results with independent techniques (e.g., RT-PCR, Western blot, proteomics)

  • Statistical approaches for reconciliation:

    • Apply meta-analysis techniques to integrate results across studies

    • Use regression-based methods rather than endpoint comparisons for time-series data

    • Implement Bayesian frameworks for updating confidence in hypotheses as new data emerges

When faced with conflicting results, researchers should systematically evaluate experimental conditions, genetic backgrounds, and methodological differences that might explain the discrepancies.

How can researchers optimize recombinant AaeA stability during purification and storage?

Maintaining protein stability throughout purification and storage is critical for successful structural and functional studies:

  • Buffer optimization approach:

    • Conduct systematic screens of buffer components:

      • pH range (typically 6.5-8.0)

      • Salt concentration (100-500 mM)

      • Detergent type and concentration

      • Stabilizing additives (glycerol, specific lipids)

  • Storage condition evaluation:

    • Test multiple storage formats:

      • Flash-frozen aliquots in liquid nitrogen

      • Storage at -80°C with cryoprotectants

      • Short-term storage at 4°C

    • Monitor protein stability and activity over time under different conditions

  • Protein engineering strategies:

    • Consider fusion with stability-enhancing partners (e.g., MBP, SUMO)

    • Introduce disulfide bonds to stabilize tertiary structure

    • Remove flexible regions prone to proteolysis

  • Quality control methods:

    • Implement regular testing protocols:

      • Size exclusion chromatography to detect aggregation

      • Activity assays to verify functional stability

      • Mass spectrometry to identify degradation products

For membrane proteins like AaeA, the choice of detergent is particularly critical. Researchers should systematically evaluate multiple detergents for their ability to maintain protein stability and function, potentially transitioning to more stable systems like nanodiscs or amphipols for long-term storage.

What are the most reliable methods for quantifying AaeA-mediated transport in experimental systems?

Accurate quantification of transport activity requires specialized methodological approaches:

  • Direct transport measurement techniques:

    • Radioactive substrate uptake/efflux assays

    • Fluorescent substrate accumulation measurements

    • HPLC-based detection of substrate levels in cellular fractions

  • Indirect functional assays:

    • Minimum inhibitory concentration (MIC) determination for substrate compounds

    • Growth curve analysis in the presence of toxic substrates

    • Bacterial survival assays under substrate stress conditions

  • Real-time monitoring approaches:

    • Whole-cell biosensors with substrate-responsive reporters

    • Membrane potential-sensitive dyes to detect efflux activity

    • Microfluidic systems for single-cell transport analysis

  • Data analysis considerations:

    • Apply appropriate kinetic models to transport data

    • Use regression-based approaches for time-course experiments

    • Account for cell-to-cell variability in population-based assays

Quantification MethodAdvantagesLimitationsAppropriate Applications
Radioactive substrate assaysHigh sensitivity, direct measurementSafety concerns, limited to available labeled compoundsDetailed kinetic studies
Fluorescent substrate assaysReal-time monitoring capabilityLimited substrate options, potential for interferenceHigh-throughput screening
Growth-based assaysPhysiologically relevant, simple setupIndirect measure, potential confounding factorsComparative studies across mutants
Membrane vesicle transportIsolated system, controlled conditionsComplex preparation, potential for resealing artifactsDetailed mechanistic studies

When designing transport quantification experiments, researchers should incorporate appropriate controls to account for non-specific transport and passive diffusion of substrates.

How might AaeA structural insights inform the development of efflux pump inhibitors?

Understanding AaeA structure provides opportunities for rational inhibitor design:

  • Structure-based drug design approaches:

    • Identify potential binding pockets at the AaeA-AaeB interface

    • Target regions essential for conformational changes during transport

    • Design peptidomimetics that disrupt critical protein-protein interactions

  • High-throughput screening strategies:

    • Develop assays suitable for compound library screening

    • Focus on functional readouts that specifically detect AaeA-dependent transport

    • Implement counter-screens to ensure specificity

  • In silico prediction methods:

    • Conduct molecular docking studies against identified binding sites

    • Perform virtual screening of compound libraries

    • Use molecular dynamics simulations to predict inhibitor effects on pump function

Research on efflux pump inhibitors should employ multidisciplinary approaches, combining structural biology, medicinal chemistry, and microbiology to develop effective compounds.

What is the evolutionary relationship between AaeA and other membrane fusion proteins in diverse bacterial species?

Evolutionary analysis of AaeA can reveal fundamental insights into efflux pump diversity:

  • Phylogenetic analysis methodology:

    • Collect homologous sequences from diverse bacterial species

    • Perform multiple sequence alignment focusing on conserved domains

    • Construct phylogenetic trees using maximum likelihood or Bayesian approaches

  • Structural comparison approaches:

    • Identify conserved structural features across the membrane fusion protein family

    • Map evolutionary conservation onto structural models

    • Correlate structural features with functional specialization

  • Horizontal gene transfer analysis:

    • Examine genomic context of aaeA homologs across species

    • Identify signature sequences indicative of horizontal transfer events

    • Compare phylogenetic patterns with species evolution

Evolutionary studies should incorporate both sequence and structural data to provide comprehensive insights into the adaptation of efflux systems across bacterial lineages.

How does AaeA contribute to bacterial adaptation to environmental stresses beyond aromatic acid efflux?

Investigating the broader physiological roles of AaeA requires integrative approaches:

  • Transcriptomic analysis under diverse stress conditions:

    • Expose bacteria to various environmental stressors (pH, temperature, antibiotics)

    • Measure aaeA expression changes using RNA-seq or microarrays

    • Identify co-regulated genes that form functional modules with AaeA

  • Metabolomic profiling methods:

    • Compare metabolite profiles between wild-type and aaeA mutant strains

    • Identify metabolic pathways affected by AaeA function

    • Determine whether AaeA influences bacterial metabolism beyond aromatic acid homeostasis

  • Systematic phenotyping approaches:

    • Screen aaeA mutants for sensitivity to diverse stress conditions

    • Assess biofilm formation, motility, and virulence factor production

    • Evaluate competitive fitness under various environmental conditions

When designing experiments to explore broader physiological roles, researchers should implement holistic approaches that capture system-level effects while maintaining methodological rigor in individual assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.