Recombinant Pachycondyla goeldii Ponericin-G3

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Recombinant Ponericin-G3 is a genetically engineered version of the native peptide, optimized for stability and scalability. It is classified under the G-family of ponericins, which share structural and functional similarities with cecropin-like peptides . Key classification details include:

PropertyDescription
Source OrganismNeoponera goeldii (subfamily: Ponerinae)
Peptide FamilyG-family (homologous to cecropins)
Native FunctionAntibacterial (Gram-positive and Gram-negative), insecticidal, and hemolytic activities

Recombinant Production

Recombinant Ponericin-G3 is synthesized using Escherichia coli expression systems, followed by purification via chromatography . Key production parameters include:

ParameterDetail
Expression HostEscherichia coli
Purity>85% (verified by SDS-PAGE)
Storage Conditions-20°C for short-term; -80°C for long-term stability
ReconstitutionDeionized sterile water with glycerol (5–50%) to prevent aggregation

Antibacterial Activity

  • Targets both Gram-positive (e.g., Staphylococcus aureus) and Gram-negative (e.g., Escherichia coli) bacteria .

  • Mechanistically disrupts microbial membranes via pore formation or "carpet model" destabilization .

Insecticidal Activity

  • Effective against insect larvae (e.g., crickets) at nanomolar concentrations .

Hemolytic Activity

  • Shows moderate hemolysis in erythrocytes, a common trait among amphipathic peptides .

Comparative Analysis of Ponericin-G Family

The G-family includes seven variants (G1–G7), with G3 distinguished by its unique residues:

PeptideAmino Acid Sequence (Key Regions Highlighted)Activity Profile
G1GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ Broad-spectrum antibacterial
G3GWKDWLNKGKEWLKKKGPGIMKAALKAATQ Enhanced stability, moderate hemolysis
G4GWKDWFKKGKELLKKKGPGIVKAALKAATQ Higher insecticidal potency

Applications and Research Implications

  • Therapeutic Potential: Candidate for novel antibiotics against multidrug-resistant pathogens .

  • Agricultural Use: Biopesticide for crop protection due to insecticidal properties .

  • Biotechnological Tools: Used in biosensor development for pathogen detection .

Limitations and Future Directions

  • Toxicity: Hemolytic activity necessitates structural optimization for clinical use .

  • Delivery Systems: Research into encapsulation or fusion proteins to enhance specificity .

Product Specs

Form
Lyophilized powder. We will ship the in-stock format unless you specify a format preference when ordering.
Lead Time
Delivery times vary by purchase method and location. Consult your local distributor for specific delivery times. Proteins are shipped with blue ice packs by default. Contact us in advance for dry ice shipping (extra fees apply).
Notes
Avoid repeated freezing and thawing. Working aliquots are stable at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening. Reconstitute protein in sterile deionized water to 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer components, storage temperature, and protein stability. Liquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
; M-poneritoxin-Ng3c; M-PONTX-Ng3c; Ponericin-G3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-30
Protein Length
Cytoplasmic domain
Purity
>85% (SDS-PAGE)
Species
Pachycondyla goeldii (Ponerine ant)
Target Protein Sequence
GWKDWLNKGK EWLKKKGPGI MKAALKAATQ
Uniprot No.

Target Background

Function
Exhibits broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, and S. cerevisiae. Also possesses insecticidal and non-hemolytic activity.
Subcellular Location
Secreted.
Tissue Specificity
Expressed by the venom gland.

Q&A

What is Ponericin-G3 and how was it initially identified?

Ponericin-G3 belongs to a family of fifteen novel peptides isolated from the venom of the predatory ant Pachycondyla goeldii. These peptides, collectively named ponericins, exhibit both antibacterial and insecticidal properties. Ponericin-G3 specifically belongs to the ponericin G family, which shares sequence similarities with cecropin-like peptides. The initial identification occurred through purification of venom components followed by amino acid sequence characterization .

Methodologically, researchers isolated these peptides through a combination of high-performance liquid chromatography (HPLC) separation techniques and mass spectrometry analysis. The antimicrobial, insecticidal, and hemolytic properties were subsequently characterized through standardized microbiological and toxicity assays.

What are the key structural features of Ponericin-G3?

Ponericin-G3, like other members of the ponericin family, is believed to adopt an amphipathic α-helical structure in polar environments such as cell membranes. This structural characteristic is crucial to its mechanism of action. The amphipathic nature creates a hydrophobic face that can interact with membrane lipids and a hydrophilic face that interacts with the aqueous environment .

The peptide's specific amino acid composition results in a net positive charge, which facilitates initial electrostatic interactions with negatively charged bacterial membranes. This structural arrangement is consistent with other cationic antimicrobial peptides that disrupt bacterial membranes.

How does Ponericin-G3 compare to other antimicrobial peptides in the ponericin family?

Ponericins are classified into three distinct families based on structural similarities: ponericin G, W, and L. Ponericin-G3 belongs to the G family, which shows homology to cecropin-like peptides. In contrast, ponericins W share similarities with gaegurins and melittin, while ponericins L are structurally related to dermaseptins .

Interestingly, even within each family, significant variations in biological activity exist. For example, some peptides within the G family may exhibit stronger antibacterial activity against specific bacterial strains, while others might demonstrate enhanced insecticidal properties. The table below summarizes the key differences between ponericin families:

FamilyStructural SimilarityPrimary Activity Profile
Ponericin GCecropin-like peptidesBroad-spectrum antibacterial activity
Ponericin WGaegurins and melittinPotent membrane disruption, higher hemolytic potential
Ponericin LDermaseptinsVariable activities against different pathogens

What expression systems are most suitable for recombinant production of Ponericin-G3?

While direct information on recombinant Ponericin-G3 production is limited in the provided search results, the optimal expression systems would follow principles established for other antimicrobial peptides. For cationic, potentially cytotoxic peptides like Ponericin-G3, bacterial expression systems using E. coli with fusion partners are typically employed to prevent toxicity to the host cells during expression.

The methodological approach involves:

  • Cloning the Ponericin-G3 sequence into an expression vector with a fusion partner (such as thioredoxin, SUMO, or glutathione S-transferase)

  • Transforming into an E. coli strain optimized for protein expression (e.g., BL21(DE3))

  • Including a cleavable linker between the fusion partner and the peptide

  • Optimizing induction conditions to maximize yield while minimizing toxicity

  • Purifying the fusion protein before cleaving to release the active peptide

For higher yields or if bacterial expression proves challenging, yeast systems like Pichia pastoris or mammalian cell lines could be considered as alternatives, though they would require distinct optimization strategies.

How can codon optimization improve recombinant Ponericin-G3 yields?

Codon optimization is particularly important for heterologous expression of ant venom peptides like Ponericin-G3. The approach involves adapting the codon usage of the peptide sequence to match the preferred codons of the expression host, which can significantly improve translation efficiency and expression yields.

For Ponericin-G3, the methodological considerations include:

  • Analyzing the natural codon usage in Pachycondyla goeldii compared to the expression host

  • Adjusting codons while maintaining the exact amino acid sequence

  • Avoiding rare codons that might cause translational pauses

  • Eliminating potential RNA secondary structures in the transcript

  • Removing cryptic splice sites or internal Shine-Dalgarno sequences when using bacterial hosts

This optimization can be performed using various algorithms and software tools specifically designed for codon optimization. Empirical testing of different optimized sequences may be necessary to identify the most productive variant.

What purification strategies work best for recombinant Ponericin-G3?

The purification of recombinant Ponericin-G3 typically involves multiple chromatographic steps, taking advantage of the peptide's unique properties:

  • Initial capture: Affinity chromatography utilizing fusion tags (His-tag, GST, etc.)

  • Tag removal: Enzymatic cleavage (TEV protease, Factor Xa, etc.) to release the peptide

  • Secondary purification: Reverse-phase HPLC to separate the peptide from the cleaved tag

  • Final polishing: Size-exclusion chromatography to achieve high purity

The cationic nature of Ponericin-G3 can also be exploited using cation exchange chromatography. For analytical confirmation of purity and identity, mass spectrometry is essential to verify the correct molecular weight and sequence of the recombinant peptide.

How does the alpha-helical structure of Ponericin-G3 contribute to its antimicrobial activity?

The alpha-helical structure of Ponericin-G3 is critical to its antimicrobial function. As with other ponericins, this peptide likely adopts an amphipathic alpha-helical conformation when interacting with biological membranes . This structural arrangement creates distinct hydrophobic and hydrophilic faces along the helix axis.

The mechanism involves:

  • Initial electrostatic attraction between the positively charged peptide and negatively charged bacterial membrane components

  • Insertion of the hydrophobic face into the lipid bilayer

  • Disruption of membrane integrity through either pore formation or a detergent-like "carpet" mechanism

  • Cellular content leakage and subsequent bacterial death

Experimental approaches to study this structure-function relationship include circular dichroism spectroscopy in membrane-mimicking environments (such as SDS micelles or phospholipid vesicles) and fluorescence studies tracking membrane permeabilization.

What amino acid residues in Ponericin-G3 are critical for its selective antimicrobial activity?

While specific residue-level analysis for Ponericin-G3 is not detailed in the provided search results, the selective antimicrobial activity of cationic peptides like ponericins typically depends on:

  • Positively charged residues (lysine, arginine): These facilitate initial binding to negatively charged bacterial membranes while reducing interaction with zwitterionic mammalian cell membranes

  • Hydrophobic residues (leucine, isoleucine, phenylalanine): These enable membrane penetration and disruption

  • Helix-promoting residues: These maintain the critical secondary structure

The methodological approach to identify critical residues involves alanine-scanning mutagenesis, where individual amino acids are systematically replaced with alanine to assess their contribution to antimicrobial activity, hemolytic activity, and structural stability.

How do modifications of the amphipathic structure affect Ponericin-G3's membrane interactions?

Modifications that alter the amphipathic nature of Ponericin-G3 would significantly impact its membrane interactions and biological activity. These modifications could include:

  • Changes in net charge: Decreasing positive charge typically reduces antimicrobial activity but may also reduce hemolytic activity

  • Alterations in hydrophobicity: Increasing hydrophobicity often enhances membrane penetration but can increase non-specific toxicity

  • Disruption of the alpha-helical structure: This generally reduces antimicrobial activity by impairing the peptide's ability to interact properly with membranes

Researchers can investigate these effects using lipid vesicle leakage assays, fluorescence spectroscopy with labeled peptides, and atomic force microscopy to visualize membrane disruption. Molecular dynamics simulations also provide valuable insights into how structural modifications affect membrane interactions at the molecular level.

What is the antimicrobial spectrum of activity for Ponericin-G3?

Ponericin-G3, like other members of the ponericin family, exhibits broad-spectrum antibacterial activity against both Gram-positive and Gram-negative bacteria . The specific minimum inhibitory concentrations (MICs) for Ponericin-G3 would need to be determined through standardized antimicrobial susceptibility testing.

Based on studies of similar antimicrobial peptides, the activity spectrum likely includes:

  • Gram-positive bacteria: Staphylococcus aureus, Bacillus subtilis, Enterococcus species

  • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa, Klebsiella pneumoniae

  • Potentially some activity against fungi, particularly Candida species

The methodology for determining this spectrum involves standardized broth microdilution assays across a range of microbial species, with appropriate controls for medium effects, inoculum density, and incubation conditions.

How does Ponericin-G3 compare to conventional antibiotics in terms of mechanism and resistance development?

Unlike conventional antibiotics that typically target specific cellular processes (cell wall synthesis, protein synthesis, DNA replication), Ponericin-G3 likely acts primarily through membrane disruption . This fundamental difference has several important implications:

  • Broader spectrum of activity, as the membrane target is conserved across many bacterial species

  • Potentially lower propensity for resistance development, as membrane composition changes require substantial genetic alterations

  • Rapid bactericidal action compared to many bacteriostatic conventional antibiotics

  • Potential activity against dormant or slow-growing bacterial populations that may be less susceptible to conventional antibiotics

The methodological approach to study resistance development involves serial passage experiments, where bacteria are repeatedly exposed to sub-lethal concentrations of the peptide to select for resistant mutants. Genomic and proteomic analysis of any resistant strains can then reveal potential resistance mechanisms.

How can Ponericin-G3 be optimized for synergistic activity with conventional antibiotics?

The potential for synergistic activity between antimicrobial peptides and conventional antibiotics is significant, as demonstrated by studies with other peptides similar to ponericins . For Ponericin-G3, optimization strategies would include:

  • Systematic screening with clinically relevant antibiotics using checkerboard assays to identify synergistic combinations

  • Investigation of sequence modifications that enhance membrane permeabilization without increasing hemolytic activity

  • Development of formulations that protect the peptide from degradation while maintaining compatibility with antibiotic partners

Research with antimicrobial peptides La47 and Pin2 has shown that combinations with antibiotics such as chloramphenicol, streptomycin, and kanamycin can yield enhanced antimicrobial effects . Similar approaches could be applied to Ponericin-G3 to identify its optimal antibiotic partners.

What experimental models are most predictive of clinical efficacy for Ponericin-G3 antimicrobial applications?

To properly evaluate the clinical potential of Ponericin-G3, a progressive series of experimental models is necessary:

  • In vitro models:

    • Standard antimicrobial susceptibility testing (broth microdilution)

    • Time-kill kinetics to assess the rate of bacterial killing

    • Biofilm susceptibility assays to evaluate activity against surface-attached communities

    • Human cell toxicity assays (e.g., hemolysis, cytotoxicity to keratinocytes or lung epithelial cells)

  • Ex vivo models:

    • Human skin explant models for topical applications

    • Blood bactericidal assays to assess activity in physiological fluids

    • Tissue infection models using harvested organs/tissues

  • In vivo models:

    • Murine systemic infection models

    • Wound infection models

    • Pulmonary infection models

    • Pharmocokinetic/pharmacodynamic (PK/PD) studies to determine optimal dosing regimens

The methodological approach should include appropriate controls, statistically sound sample sizes, and clinically relevant endpoints such as bacterial load reduction, tissue damage assessment, and host immune response markers.

How do in vitro versus in vivo activities of Ponericin-G3 differ, and what factors influence this discrepancy?

Several factors can lead to discrepancies between in vitro and in vivo antimicrobial activities of peptides like Ponericin-G3:

  • Protein binding: Serum proteins can bind to cationic peptides, reducing their effective concentration

  • Proteolytic degradation: Host proteases may degrade the peptide before it reaches its target

  • Salt sensitivity: Many antimicrobial peptides show reduced activity at physiological salt concentrations

  • pH effects: Tissue microenvironments may have pH values that affect peptide structure and function

  • Immune system interactions: The peptide may trigger immune responses that either enhance or interfere with its activity

Methodologically, these factors can be studied by:

  • Conducting antimicrobial assays in the presence of serum or specific proteins

  • Measuring peptide stability in biological fluids over time

  • Testing activity across different salt concentrations and pH values

  • Evaluating immune cell responses to the peptide in vitro

What are the mechanisms of bacterial resistance to Ponericin-G3 and how can they be overcome?

While specific resistance mechanisms against Ponericin-G3 are not detailed in the provided search results, bacteria typically develop resistance to antimicrobial peptides through several mechanisms:

  • Membrane modifications: Changes in charge or fluidity that reduce peptide binding or insertion

  • Efflux pumps: Active expulsion of the peptide from the bacterial cell

  • Proteolytic degradation: Production of enzymes that cleave and inactivate the peptide

  • Biofilm formation: Creating a protected environment with altered susceptibility

Strategies to overcome these resistance mechanisms include:

  • Developing peptide analogs with modified sequences that maintain activity against resistant strains

  • Combination therapy with conventional antibiotics or other antimicrobials

  • Encapsulation to protect from proteolytic degradation

  • Inclusion of biofilm-disrupting agents in formulations

Research approaches would involve generating resistant mutants in the laboratory, characterizing their resistance mechanisms, and then testing modification strategies to restore antimicrobial activity.

What are the critical parameters for evaluating the stability of recombinant Ponericin-G3?

Stability assessment is crucial for any therapeutic peptide development. For recombinant Ponericin-G3, critical parameters include:

  • Physical stability:

    • Temperature stability (thermal denaturation profiles)

    • pH stability (structure retention across physiological pH range)

    • Aggregation propensity (using dynamic light scattering or size-exclusion chromatography)

    • Freeze-thaw stability for storage considerations

  • Chemical stability:

    • Oxidation susceptibility (particularly of methionine residues)

    • Deamidation of asparagine and glutamine residues

    • Disulfide bond formation/scrambling (if applicable)

  • Biological stability:

    • Proteolytic resistance in relevant biological fluids

    • Activity retention after exposure to physiological conditions

    • Immunogenicity assessment using in silico and in vitro methods

Accelerated stability studies using elevated temperatures can provide predictive data on long-term stability at storage conditions. Analytical techniques such as RP-HPLC, mass spectrometry, and circular dichroism are essential for comprehensive stability evaluation.

What experimental controls are essential in antimicrobial assays using Ponericin-G3?

Proper controls are critical for reliable antimicrobial testing with Ponericin-G3:

  • Positive controls:

    • Reference antibiotics with established activity against test organisms

    • Related antimicrobial peptides with known potency

    • Commercial preparations of similar peptides if available

  • Negative controls:

    • Vehicle/solvent controls (to confirm lack of antimicrobial activity)

    • Scrambled peptide sequence (maintaining same amino acid composition but disrupting structure)

    • Non-antimicrobial peptide of similar size

  • Experimental controls:

    • Inoculum verification (to confirm correct bacterial concentration)

    • Growth controls (to confirm viability of test organisms)

    • Media controls (to confirm sterility and appropriate growth conditions)

    • pH controls (to ensure activity is not due to pH effects)

Additionally, time-dependent experiments should include multiple timepoints to establish kinetics, and dose-response studies should use a sufficient range of concentrations to determine accurate MIC values.

How should MIC (Minimum Inhibitory Concentration) assays be modified for cationic peptides like Ponericin-G3?

Standard MIC assays require specific modifications when testing cationic antimicrobial peptides like Ponericin-G3:

  • Medium considerations:

    • Use of cation-adjusted Mueller-Hinton broth to standardize divalent cation concentrations

    • Avoidance of phosphate-buffered media which can bind cationic peptides

    • Consideration of lower-salt media for initial screening, with validation in physiological salt conditions

  • Material considerations:

    • Use of non-binding materials (polypropylene instead of polystyrene) for microplate assays

    • Pre-treatment of surfaces with albumin or other blocking agents to prevent peptide binding

    • Validation that peptide concentration remains constant throughout the assay

  • Technical considerations:

    • Extended incubation times to capture slower killing kinetics

    • Multiple endpoints (turbidity, resazurin reduction, colony counting) for confirmation

    • Standardized bacterial inoculum preparation to ensure consistent cell membrane states

These modifications help ensure that the measured MIC values accurately reflect the peptide's intrinsic antimicrobial activity rather than experimental artifacts.

What are the primary challenges in transitioning recombinant Ponericin-G3 from laboratory to clinical applications?

Despite the promising antimicrobial properties of peptides like Ponericin-G3, several challenges exist in their clinical development:

  • Manufacturing challenges:

    • Scale-up of recombinant production while maintaining biological activity

    • Cost-effective purification processes suitable for GMP production

    • Batch-to-batch consistency in activity and purity

  • Pharmacological challenges:

    • Limited systemic bioavailability due to proteolytic degradation

    • Potential immunogenicity of ant-derived peptides

    • Toxicity concerns, particularly hemolytic activity

    • Narrow therapeutic window between antimicrobial and cytotoxic concentrations

  • Regulatory challenges:

    • Establishing appropriate quality control standards

    • Defining suitable animal models for preclinical safety and efficacy

    • Addressing potential allergic reactions, as demonstrated by reported anaphylaxis cases from P. goeldii stings

Addressing these challenges requires interdisciplinary approaches combining protein engineering, pharmaceutical formulation, and preclinical testing with appropriate models.

How can immunogenicity concerns with recombinant Ponericin-G3 be addressed?

Immunogenicity is a significant concern for therapeutic peptides, especially those derived from non-human sources like ant venom. There is documented evidence of allergic reactions to P. goeldii venom proteins, with IgE-reactive proteins identified in the 30-45 kDa range . Strategies to address immunogenicity include:

  • Sequence modification:

    • Identification and modification of potential T-cell epitopes

    • Humanization of sequences while preserving antimicrobial activity

    • PEGylation or other modifications to mask immunogenic epitopes

  • Formulation approaches:

    • Encapsulation in liposomes or nanoparticles to reduce immune recognition

    • Local delivery systems to minimize systemic exposure

    • Co-administration with immunomodulatory agents

  • Screening methods:

    • In silico prediction of immunogenic epitopes

    • Ex vivo human T-cell activation assays

    • HLA binding assays to assess potential for antigen presentation

The methodological approach should involve iterative design and testing, with careful evaluation of both efficacy and immunogenicity at each stage.

What emerging technologies might enhance the therapeutic potential of recombinant Ponericin-G3?

Several cutting-edge technologies could significantly improve the development of Ponericin-G3 as a therapeutic:

  • Advanced delivery systems:

    • Stimulus-responsive polymers for targeted release

    • Cell-penetrating peptide conjugates for enhanced cellular delivery

    • Biofilm-penetrating nanoparticles for infection site targeting

    • Antimicrobial peptide-antibiotic conjugates for dual-mechanism action

  • Production technologies:

    • Cell-free protein synthesis for rapid production of peptide variants

    • Microbial strain engineering for enhanced expression and reduced proteolysis

    • Continuous manufacturing processes for cost-effective scale-up

  • Design approaches:

    • Machine learning algorithms for optimizing sequence-activity relationships

    • Hybrid peptides combining elements from different antimicrobial peptide families

    • Cyclic peptide modifications for enhanced stability

  • Combination therapies:

    • Synergistic formulations with conventional antibiotics as demonstrated with similar antimicrobial peptides

    • Combinations with immune modulators to enhance host defense

    • Multi-peptide cocktails targeting different mechanisms of action

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.