| Ponericin | Sequence | Length |
|---|---|---|
| G1 | GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ | 27 |
| G6 | GLVDVLGKVGGLIKKLLP | 18 |
| G7 | GLVDVLGKVGGLIKKLLPG | 19 |
Recombinant Ponericin-G6 is synthesized using heterologous expression systems. Key production details include:
Expression hosts: Yeast (Pichia pastoris), E. coli, baculovirus, and mammalian cells .
Storage: Stable at -20°C or -80°C with glycerol (5–50%) to prevent aggregation .
| Parameter | Detail |
|---|---|
| Uniprot ID | P82419 |
| Molecular weight | ~2.1 kDa |
| Tag | Determined during manufacturing |
| Reconstitution | Deionized sterile water (0.1–1.0 mg/mL) |
Ponericin-G6 demonstrates multifaceted bioactivity:
Antibacterial action: Effective against Gram-positive (Staphylococcus aureus) and Gram-negative (Escherichia coli) bacteria via membrane permeabilization .
Insecticidal activity: Targets cricket larvae, suggesting defensive/ecological roles in ant colonies .
Hemolytic effects: Observed at high concentrations, limiting therapeutic utility .
| Activity Type | Target Organisms/Effects |
|---|---|
| Antibacterial | Gram-positive/-negative bacteria |
| Insecticidal | Cricket larvae (LD₅₀: 15–20 μg/g) |
| Hemolytic | Mammalian erythrocytes (HC₅₀: >50 μM) |
Ponericin-G6 disrupts microbial membranes through:
Electrostatic interaction: Binds to anionic phospholipids on bacterial surfaces .
Pore formation: Induces lipid bilayer destabilization via α-helix insertion .
Secondary effects: Potential interference with intracellular targets (e.g., enzyme inhibition) .
Antimicrobial therapy: A candidate for combating antibiotic-resistant pathogens .
Agricultural use: Insecticidal properties may inform eco-friendly pest control .
Biotechnological tool: Serves as a template for engineering peptides with reduced hemolysis .
Ponericin-G6 is an antimicrobial peptide that belongs to the ponericin G family, originally isolated from the venom of the predatory ant Pachycondyla goeldii, a member of the subfamily Ponerinae . Ponericins are a group of novel peptides exhibiting antibacterial and insecticidal properties. Specifically, the G family of ponericins shares high sequence similarities with cecropin-like peptides . For research purposes, recombinant Ponericin-G6 is produced using E. coli expression systems , allowing for consistent production of the peptide for experimental investigations into its antimicrobial and structural properties.
The amino acid sequence of Ponericin-G6 is GLVDVLGKVG GLIKKLLP . This 18-amino acid peptide has an expression region of 1-18 . The sequence characteristics contribute to the peptide's amphipathic nature, which is critical for its antimicrobial activity. The specific arrangement of hydrophobic and hydrophilic residues enables the peptide to interact with bacterial membranes and exert its antimicrobial effects.
Recombinant Ponericin-G6 should be stored at -20°C for regular use, and for extended storage, it should be conserved at either -20°C or -80°C . Repeated freezing and thawing is not recommended as it may affect the stability and activity of the peptide. For working with the protein, it is advisable to prepare aliquots and store them at 4°C for up to one week to avoid repeated freeze-thaw cycles . When preparing the aliquots, it is important to ensure that the reconstitution buffer is appropriate for the planned experiments.
For reconstitution of Recombinant Ponericin-G6, it is recommended to briefly centrifuge the vial prior to opening to bring the contents to the bottom . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . To enhance stability during storage, it is recommended to add glycerol to a final concentration of 5-50%, with the product datasheet default recommendation being 50% . After reconstitution, the solution should be appropriately aliquoted to avoid repeated freeze-thaw cycles.
Ponericin-G6 is one of fifteen novel peptides identified from the venom of Pachycondyla goeldii, which collectively are classified into three families: ponericin G, W, and L . Ponericin-G6 belongs to the G family, which shares sequence similarities with cecropin-like peptides, whereas ponericins W show similarities to gaegurins and melittin, and ponericins L are related to dermaseptins . Each family has distinct structural characteristics and potentially different mechanisms of action. In comparative analyses, Ponericin-G6 and Ponericin-G7 have been noted to have similar structural characteristics, both showing less than 90% of their amino acid residues in the Ramachandran Plot, which distinguishes them somewhat from other ponericins .
Ponericin-G6 is characterized by its relatively short sequence (18 amino acids) with a specific arrangement of amino acids that likely forms an amphipathic structure . Computational analyses conducted on ponericin-like peptides, including Ponericin-G6, have generated three-dimensional theoretical models to understand their structural properties . These models can be evaluated using servers like ProSA-web, PROCHECK, and MolProbity . The peptide's structure has been further refined through unconstrained molecular dynamics simulations in saline solution (ionic strength 0.15 mol L−1 NaCl) using the GROMOS96 43A1 force field .
Ponericin-G6, like other members of the ponericin family, exhibits antibacterial properties against both Gram-positive and Gram-negative bacteria . The antimicrobial activities of ponericins were investigated together with their insecticidal activities against cricket larvae and their hemolytic activities . The specific antimicrobial mechanism likely involves the peptide's amphipathic structure enabling interaction with bacterial cell membranes, possibly leading to membrane disruption and subsequent bacterial cell death. The exact spectrum of activity and potency of Ponericin-G6 compared to other antimicrobial peptides requires standardized assays measuring minimum inhibitory concentrations (MICs) against reference bacterial strains.
Setting up effective molecular dynamics (MD) simulations to study Ponericin-G6's interactions with bacterial membranes requires careful attention to multiple parameters:
Initial Structure Preparation: Generate a theoretical model of Ponericin-G6 based on its amino acid sequence and validate using tools like ProSA-web, PROCHECK, and MolProbity .
Membrane Model Selection: Create models representing typical bacterial membranes with appropriate lipid compositions.
Simulation Parameters: Use established force fields like GROMOS96 43A1 that have been validated for peptide-membrane systems . Apply appropriate algorithms such as SETTLE for water geometry constraints and LINCS for atomic binding lengths . Implement Particle Mesh Ewald (PME) for electrostatic corrections with a cutting radius of approximately 1.4 nm .
System Setup: Place Ponericin-G6 at different starting positions relative to the membrane and ensure proper solvation with explicit water molecules. Add ions to achieve physiological ionic strength (0.15 mol L⁻¹ NaCl) .
Analysis Methods: Calculate peptide secondary structure evolution, measure peptide-membrane contacts, and analyze water penetration and potential pore formation.
Several computational methods have been employed to predict the biological activities of ponericin-like peptides, including Ponericin-G6 :
Machine Learning Algorithms: Support Vector Machine (SVM), Random Forest (RF), Artificial Neural Network (ANN), and Discriminant Analysis (DA) algorithms from CAMP R3 have been used to predict antibacterial activity .
Specialized Predictors: Tools like the DBAASP server and Sense the Moment (STM) provide additional prediction capabilities specifically designed for antimicrobial peptides .
Physicochemical Property Analysis: The HeliQuest server calculates parameters like net charge, hydrophobicity, and hydrophobic moment, generating helical wheel diagrams that visualize the distribution of amino acids in potential helical structures .
Molecular Dynamics Simulations: Using force fields like GROMOS96 43A1 with appropriate algorithms allows researchers to simulate the peptide's behavior in solution and potentially its interactions with membranes .
For comprehensive analysis, a combination of these methods is most effective, as each provides different insights into the peptide's potential activities.
When designing experiments to investigate the structure-function relationship of Ponericin-G6, researchers should consider:
Sequence Modification Approaches:
Alanine scanning to identify critical residues
Conservative vs. non-conservative substitutions
Truncation studies to identify the minimal active sequence
Structural Analysis Techniques:
Functional Assays:
Comparative Analysis:
Optimizing assays for detecting Ponericin-G6's antibacterial effects requires:
Bacterial Strain Selection: Test against diverse Gram-positive and Gram-negative bacteria to determine the spectrum of activity .
Growth Medium Optimization: Test multiple media formulations to identify conditions that allow for optimal detection of Ponericin-G6's effects.
Peptide Preparation: Ensure proper reconstitution according to recommended protocols (0.1-1.0 mg/mL in deionized sterile water) .
Assay Format Selection:
Broth microdilution assays for MIC determination
Agar diffusion assays for zones of inhibition
Time-kill kinetics assays
Flow cytometry for assessing membrane integrity
Detection Methods: Choose appropriate methods for quantifying bacterial growth or death, such as optical density measurements, colony-forming unit (CFU) counting, or colorimetric viability indicators.
When designing experiments to test Ponericin-G6's antimicrobial activity, several controls should be included:
Positive Controls: Include known antimicrobial agents with established efficacy.
Negative Controls: Use the buffer or solvent used for Ponericin-G6 reconstitution without the peptide .
Vehicle Controls: If any carriers or additives (such as glycerol) are used in the peptide preparation, controls containing these components without the peptide should be tested .
Concentration Gradient: Test multiple concentrations to establish dose-response relationships.
Time Course Controls: Sample at different time points to understand the kinetics of antimicrobial activity.
Bacterial Viability Controls: Include controls that verify the initial viability of the bacterial cultures.
Specificity Controls: Test against different bacterial strains to determine the spectrum of activity .
Contradictory results in Ponericin-G6 activity assays can arise from various sources and require careful interpretation:
Methodological Differences: Analyze differences in assay formats and detection methods.
Experimental Conditions: Evaluate the impact of growth media composition, pH, ionic strength, and temperature on peptide activity.
Peptide Preparation Variables: Examine differences in peptide source, presence of tags in recombinant preparations , and reconstitution methods and storage conditions .
Bacterial Strain Differences: Even within the same species, different strains may show varying susceptibility.
Statistical Considerations: Evaluate whether contradictions are statistically significant or within expected variability.
Mechanistic Reconciliation: Consider whether contradictory results might reflect different mechanisms of action under different conditions.
When analyzing dose-response data for Ponericin-G6, several statistical approaches can be applied:
Determination of IC50/EC50/MIC Values: Use nonlinear regression analysis with sigmoidal dose-response models.
Curve Fitting and Model Selection: Compare different mathematical models using Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC).
Statistical Significance Testing: Apply ANOVA with post-hoc tests for comparing multiple concentrations.
Variability Analysis: Calculate confidence intervals for IC50/EC50/MIC values and use bootstrap resampling for robust estimation of parameter uncertainty.
Time-Dependent Analysis: For time-kill curves, consider area under the curve (AUC) analysis and apply time-to-event statistics for survival data.
Multivariate Approaches: Use principal component analysis (PCA) or factor analysis when integrating multiple response variables.
Distinguishing between direct antimicrobial effects and secondary effects requires:
Time-Course Analysis: Monitor bacterial viability at short time intervals (minutes rather than hours).
Mechanistic Assays: Conduct membrane permeabilization assays using fluorescent dyes and membrane potential measurements using voltage-sensitive dyes.
Microscopy Techniques: Use electron microscopy to visualize bacterial cell morphology changes and fluorescence microscopy with labeled Ponericin-G6 to track localization.
Control Experiments: Test Ponericin-G6 against liposomes mimicking bacterial membranes but lacking cellular components.
Concentration-Dependent Studies: Examine if different mechanisms predominate at different peptide concentrations.
Comparative Analysis: Compare effects with those of known membrane-active peptides and conventional antibiotics.
Several bioinformatic tools and approaches are valuable for comparing Ponericin-G6 with other antimicrobial peptides:
Sequence Analysis Tools: Use BLAST for identifying similar sequences and multiple sequence alignment software for aligning Ponericin-G6 with other antimicrobial peptides.
Antimicrobial Peptide Databases: The Antimicrobial Peptide Database (APD) contains information on ponericin-like peptides .
Physicochemical Property Calculators: HeliQuest for analyzing amphipathicity and generating helical wheel diagrams .
Structure Prediction and Analysis: ProSA-web, PROCHECK, and MolProbity for evaluating structural model quality .
Activity Prediction Algorithms: CAMP R3 algorithms (SVM, RF, ANN, DA) for predicting antimicrobial activity .
Molecular Visualization and Analysis: PyMOL or UCSF Chimera for visualizing and comparing 3D structures.
The structure-function relationship of Ponericin-G6 involves:
Theoretical models for Ponericin-G6's mechanism of action include:
Physicochemical Property Analysis: Using the HeliQuest server to generate helical wheel diagrams that visualize the distribution of charged and hydrophobic residues, crucial for understanding potential membrane interactions .
Molecular Dynamics Simulations: Unconstrained molecular dynamics simulations in saline solution provide insights into the peptide's behavior in a physiologically relevant environment . These simulations can reveal structural changes, stable conformations, and potential interaction modes with bacterial membranes.
Simulation Parameters: The simulations can be performed using force fields like GROMOS96 43A1, with algorithms such as SETTLE and LINCS constraining water geometries and binding lengths, respectively .
Membrane Interaction Models: The predicted mechanism likely involves the peptide's amphipathic structure enabling interaction with bacterial cell membranes, possibly leading to membrane disruption and subsequent bacterial cell death.
Recombinant Ponericin-G6 is produced using Escherichia coli (E. coli) expression systems . This bacterial expression system allows for efficient production of the peptide in sufficient quantities for research purposes. The recombinant protein may include a tag, although the specific tag type is typically determined during the manufacturing process . When using recombinant Ponericin-G6 for experiments, researchers should consider the potential effects of any tags on the peptide's structure and function, particularly if the tag has not been removed during the purification process.