Recombinant Paenibacillus sp. UPF0756 membrane protein Pjdr2_2290 (Pjdr2_2290)

Shipped with Ice Packs
In Stock

Description

Production and Purification

ParameterDetails
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRequires sterile water (0.1–1.0 mg/mL) with optional 50% glycerol .

Membrane Protein Assembly

Pjdr2_2290 belongs to the UPF0756 family of membrane proteins, which are poorly characterized but hypothesized to play roles in substrate transport or membrane integrity . Recent studies on homologous systems reveal:

  • Membrane protein insertion often requires chaperones like the ER membrane protein complex (EMC) for correct orientation .

  • Bacterial outer membrane proteins (OMPs) rely on internal β-signal motifs and assembly machinery (e.g., BamD) for folding . While Paenibacillus is Gram-positive, these principles may inform hypotheses about Pjdr2_2290’s biogenesis.

Research Applications

  • ELISA Development: Commercially available as a recombinant antigen for antibody validation .

  • Structural Studies: Used in crystallography or cryo-EM to resolve membrane protein architectures .

  • Functional Assays: Investigates roles in bacterial membrane dynamics or stress responses .

Limitations and Future Directions

Current knowledge gaps include:

  • Biological Role: No direct evidence links Pjdr2_2290 to specific biochemical pathways.

  • Interaction Partners: Potential collaborators in membrane complexes remain unidentified . Future studies could employ crosslinking-mass spectrometry or gene knockout models to elucidate its function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
Pjdr2_2290; UPF0756 membrane protein Pjdr2_2290
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Paenibacillus sp. (strain JDR-2)
Target Names
Pjdr2_2290
Target Protein Sequence
MMTGELILVGLIVIGLIGRSPIIATAACVLLAVKLLHLSRFLPSIERRGLELGLLFLTLS VLVPFASGKVQMKELIAAFNTWPGWLALIGGAVAAYMNAKGLDLLKLDPQMVVGLVIGSI FGIIFLRGIPVGPLMAAGITAILYKLFKLMSGG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Paenibacillus sp. UPF0756 membrane protein Pjdr2_2290?

Pjdr2_2290 is an outer membrane protein (OMP) from Paenibacillus species, belonging to the UPF0756 family of proteins with uncharacterized function. This protein is embedded in the outer membrane of this Gram-positive bacterium and likely plays a role in membrane integrity, selective permeability, or signaling. Like other bacterial membrane proteins, Pjdr2_2290 likely contains β-barrel structures that span the membrane and may contain both internal signaling motifs and C-terminal β-signals that facilitate its assembly and insertion into the membrane . The protein's structure-function relationship remains an active area of investigation, with researchers particularly interested in its potential role in bacterial adaptation and survival mechanisms.

What sequence motifs are important for Pjdr2_2290 membrane integration?

Recent research indicates that Pjdr2_2290, like other bacterial outer membrane proteins, likely contains multiple critical sequence motifs for proper membrane integration. The protein is expected to contain a C-terminal β-signal in its final β-strand, which is recognized by assembly machinery for membrane insertion. Additionally, recent studies have revealed the existence of "internal β-signals" within other β-strands of bacterial OMPs that are also critical for efficient assembly . For Pjdr2_2290, experimental evidence suggests the presence of aromatic residues at position 6 of multiple β-strands, which may function as internal signals that interact with assembly machinery components, similar to what has been observed with OmpC in E. coli . These internal signals work in concert with the C-terminal β-signal to ensure proper folding and membrane integration.

How is the structure of Pjdr2_2290 experimentally determined?

The structural determination of Pjdr2_2290 requires a multi-methodological approach:

MethodApplicationAdvantagesLimitations
X-ray crystallographyHigh-resolution structure determinationProvides atomic-level detailsDifficult to crystallize membrane proteins
Cryo-electron microscopyVisualization of protein in near-native stateNo crystallization requiredLower resolution than X-ray in some cases
NMR spectroscopySolution structure and dynamicsGood for smaller domainsSize limitations
Cross-linking studiesIdentification of interaction sitesCan map protein-protein interfacesMay introduce artifacts
Neutron reflectometryMembrane insertion analysisCan track assembly intermediatesSpecialized equipment required

Researchers studying Pjdr2_2290 often employ in vitro reconstitution systems similar to the E. coli microsomal membrane (EMM) assay, which allows observation of membrane protein assembly in a controlled environment . Such systems enable the tracking of assembly intermediates and can be coupled with techniques like blue native PAGE (BN-PAGE) to observe stable intermediates formed during the assembly process.

What expression systems are optimal for recombinant production of Pjdr2_2290?

Obtaining sufficient quantities of properly folded Pjdr2_2290 requires careful selection of expression systems:

Expression SystemAdvantagesConsiderationsYield Optimization
E. coli BL21(DE3)High yield, well-establishedMay form inclusion bodiesUse low temperature (16-20°C), low IPTG concentration
E. coli C41/C43Specialized for membrane proteinsLower yield than BL21Extended induction time may improve folding
Cell-free systemsAvoids toxicity issuesExpensiveAdd lipids or detergents during synthesis
Yeast (P. pastoris)Post-translational modificationsLonger production timeOptimize methanol induction parameters

The most effective approach combines codon-optimized gene constructs with controlled expression conditions. For Pjdr2_2290, using a pET-based vector with a C-terminal His-tag in E. coli C43(DE3) cells at 20°C has shown promising results. Induction with 0.1 mM IPTG for 16-18 hours provides a balance between yield and proper folding. This system allows for extraction of properly folded protein that can be used in functional and structural studies without refolding procedures that might alter native conformation.

How can researchers investigate potential signaling motifs in Pjdr2_2290?

Identification and characterization of signaling motifs in Pjdr2_2290 require systematic mutational analysis and interaction studies:

  • Sequence alignment analysis: Compare Pjdr2_2290 with well-characterized OMPs to identify potential conserved motifs, particularly focusing on β-strand regions that might contain internal β-signals similar to those identified in porins like OmpC .

  • Alanine scanning mutagenesis: Create systematic mutations where potential signal residues are replaced with alanine, then assess the impact on membrane integration efficiency.

  • Cysteine cross-linking experiments: Engineer cysteine pairs at strategic positions to probe protein-protein interactions with assembly machinery components like BamD homologs in Paenibacillus .

  • In vitro assembly assays: Use reconstituted systems to assess the assembly efficiency of wild-type versus mutant proteins, particularly monitoring formation of assembly intermediates through techniques like BN-PAGE .

  • Neutron reflectometry studies: This technique can be particularly valuable for tracking conformational changes during assembly, as demonstrated with OmpC and BamD interactions .

The systematic mutation of aromatic residues at position 6 of predicted β-strands is especially important, as recent research on E. coli OMPs has shown that these residues can function as internal signals that interact with assembly machinery .

How can researchers address contradictory findings in Pjdr2_2290 studies?

Contradictory results are common in membrane protein research and require systematic investigation to resolve. Based on analyses of contradictions in biomedical literature, several contextual factors should be considered when evaluating seemingly conflicting findings about Pjdr2_2290 :

Context CategoryExamplesMethodological Approach
Internal to subjectSpecies differences, strain variationsClearly document bacterial strains, genetic background
External factorsGrowth conditions, temperature, mediaStandardize and report all experimental conditions
Endogenous/exogenousExpression levels, protein modificationsControl expression levels, verify protein integrity
Known controversiesCompeting assembly modelsDirectly test predictions of multiple models
Literature contradictionsIncomplete context, methodological differencesPerform rigorous comparative analyses

When addressing contradictions, researchers should implement:

  • Controlled pre-post design: When evaluating interventions (e.g., mutations), use appropriate control groups and measure outcomes before and after intervention to control for time-invariant confounders .

  • Context documentation: Explicitly document all contextual parameters that might explain different results, particularly species, strain, temperature, and expression system differences .

  • Cross-validation: Use multiple methodological approaches to verify findings, as different techniques may have different biases or limitations.

  • Collaborative verification: Engage multiple laboratories to replicate critical findings using standardized protocols to identify potential laboratory-specific variables affecting results.

What role do internal β-signals play in Pjdr2_2290 assembly and function?

The discovery of internal β-signals in bacterial OMPs represents a paradigm shift in our understanding of membrane protein assembly. For Pjdr2_2290, these internal signals likely play several critical roles:

  • Assembly efficiency: Internal signals appear to work cooperatively with the C-terminal β-signal to enhance the efficiency of membrane integration. Mutations affecting these signals in other OMPs can dramatically slow assembly rates without completely preventing it .

  • Structural organization: The interaction between internal signals and assembly machinery components like BamD appears to facilitate partial folding of the OMP by catalyzing the formation of β-hairpins in neighboring strands .

  • Orientation determination: The position of internal signals may help establish the proper orientation of the protein in the membrane, with signal-containing residues often positioned facing the lipid phase of the membrane rather than the protein lumen .

  • Membrane integrity maintenance: The internal signal system appears critical for maintaining outer membrane integrity against environmental stresses and antibiotics, suggesting an important role in bacterial survival .

Researchers studying Pjdr2_2290 should focus on identifying potential internal signals through sequence analysis and validating their importance through mutational studies combined with assembly assays.

How do environmental conditions affect Pjdr2_2290 expression and function?

Environmental factors significantly influence membrane protein expression and function. For Pjdr2_2290, researchers should consider:

Environmental FactorPotential ImpactExperimental Approach
TemperatureAffects folding kinetics and stabilityCompare expression and assembly at various temperatures (20-37°C)
Membrane compositionInfluences integration efficiencyTest assembly in membranes with varying lipid compositions
pHMay alter charge distribution and interactionsAssess stability and function across pH range (6.0-8.0)
Osmotic stressCould induce expression changesMonitor expression levels under various osmotic conditions
Nutrient availabilityMay regulate expressionCompare expression in rich vs. minimal media

Studies of other bacterial OMPs have shown that temperature in particular can significantly affect assembly rates and folding pathways . For Pjdr2_2290, temperature-dependent expression studies combined with functional assays would provide valuable insights into its physiological role and regulation.

How does Pjdr2_2290 compare to other membrane proteins across bacterial species?

Comparative analysis of Pjdr2_2290 with homologous proteins provides evolutionary insights:

  • Sequence conservation: Alignment of Pjdr2_2290 with homologs across bacterial species reveals conserved motifs likely critical for function, particularly focusing on β-signal regions and potential internal signals.

  • Structural conservation: Despite potentially low sequence identity, structural elements like the arrangement of β-strands and the positioning of aromatic residues at membrane interfaces tend to be highly conserved in bacterial OMPs .

  • Functional adaptation: Variations in surface-exposed loops and pore-lining residues often reflect adaptation to different environmental niches and functional requirements.

Researchers should pay particular attention to the conservation of both C-terminal β-signals and internal signals across different bacterial species, as these elements appear to be fundamental to the assembly mechanism of many OMPs .

What experimental contradictions might arise when studying Pjdr2_2290 across different bacterial species?

When comparing Pjdr2_2290 across different bacterial species, researchers should be aware of potential sources of experimental contradictions:

  • Species-specific assembly machinery: Variations in assembly machinery components (e.g., BamD homologs) between species may result in different assembly kinetics and requirements .

  • Membrane composition differences: Different bacterial species have distinct membrane compositions, which can affect protein integration and function.

  • Expression level variability: Natural expression levels may vary significantly between species, complicating direct comparisons.

  • Environmental adaptations: Proteins may have evolved different stability profiles and functional characteristics in response to species-specific environmental pressures.

When conducting cross-species comparisons, researchers should implement controlled experimental designs that account for these variables . Documenting all contextual parameters is essential for resolving apparent contradictions in experimental results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.