Recombinant Palmaria palmata Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant production uses E. coli expression systems, followed by chromatographic purification:

  • Expression System: E. coli BL21(DE3) or similar strains .

  • Purification: Immobilized metal-affinity chromatography (IMAC) via His tag .

  • Purity: >90% by SDS-PAGE .

  • Storage: Lyophilized in Tris/PBS buffer (pH 8.0) with 6% trehalose or 50% glycerol at -80°C .

Stability Considerations:

  • Repeated freeze-thaw cycles degrade functionality .

  • Short-term storage at 4°C (≤1 week) is feasible for experimental use .

Photosynthesis Studies

  • Role in PSII: Binds plastoquinone (Q<sub>B</sub>), facilitating electron transfer from pheophytin to the quinone pool .

  • Photoinhibition Resistance: Mutational studies on D1 protein dynamics under high-light stress .

Biotechnological Innovations

  • Protein Engineering: Serves as a template for modifying electron transport efficiency in synthetic biology .

  • Enzymatic Activity: EC 1.10.3.9 (quinol oxidase activity) .

Comparative Analysis of Extraction Methods

Recent advances in protein extraction from P. palmata highlight methods applicable to recombinant variants:

MethodYieldPurityKey AdvantageSource
Microwave Digestion47.6%89.8%Preserves protein integrity
Acid Hydrolysis46.5%65.3%Cost-effective for large-scale processing
Enzymatic Assisted (EAE)38–41%*75–79%*Targets carbohydrate-protein complexes

*Values represent protein enrichment in pellets post-extraction .

Challenges and Future Directions

  • Structural Complexity: The D1 protein’s transmembrane domains complicate crystallization for structural studies .

  • Scalability: Optimizing E. coli expression for high-yield production remains a bottleneck .

  • Ecological Relevance: Studies on wild-type P. palmata D1 protein adaptation to oceanic light gradients inform recombinant applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Palmaria palmata (Dulse) (Rhodymenia palmata)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWERFCTWITSTENRLYIGWFGVVMIPTLLTATSVFIIAFVAAPPVDI DGIREPVAGSLLYGNNIISGAIIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLIVLHFL LGVCCYIGREWELSYRLGMRPWISVAFTAPVAAAAAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVVGIWLTSMSVSTMALNLNGF NFNQSVVDSQGRVINTWADILNRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Palmaria palmata Photosystem Q(B) protein and what is its role in photosynthesis?

Palmaria palmata Photosystem Q(B) protein, also known as Photosystem II protein D1 or PSII D1 protein, is a key component of the photosynthetic machinery in the red seaweed Palmaria palmata (also called Dulse or Rhodymenia palmata) . It functions within Photosystem II, where it plays a critical role in electron transport during the light-dependent reactions of photosynthesis. This protein is encoded by the psbA gene and is essential for the conversion of light energy to chemical energy in the form of ATP and NADPH during photosynthesis .

How does seasonal variation affect protein content in Palmaria palmata?

Research has demonstrated significant seasonal variations in the protein content of Palmaria palmata. Based on nitrogen level measurements, the protein content ranges from 9.7% to 25.5% of the dry mass throughout the year, with a yearly average of 18.3 ± 5.9% . Maximum protein values (21.9 ± 3.5%) occur during the winter–spring period, while lower levels (11.9 ± 2.0%) are observed during the summer–early autumn period . This seasonal variation is important to consider when planning harvesting for protein extraction or when comparing experimental results obtained from samples collected at different times of the year.

How do different light conditions affect the expression and functionality of Photosystem Q(B) protein in P. palmata?

Different light conditions significantly impact the nitrogen content and protein expression in Palmaria palmata. Research has shown that blue light exposure for 12 days can lead to an 11.2% increase in protein content compared to the initial sample . When comparing different light regimes (white, red, blue, and green), a significant decrease in total nitrogen (TN), non-protein nitrogen (NPN), and protein nitrogen (PN) was observed on day 6, followed by an increase on day 12 in P. palmata samples cultured under blue light .

The protein content of the initial sample on day 0 was 15.0% (w/w dry weight), whereas a maximum protein content of 16.7% (w/w) was obtained during exposure to blue light following 12 days of culture . Additionally, electrophoretic analysis along with amino acid profiling revealed light-related changes in protein composition, indicating that lighting regime influences not only the quantity but also the quality of proteins expressed .

What are the challenges in recombinant expression of full-length Photosystem Q(B) protein?

The recombinant expression of full-length Photosystem Q(B) protein from P. palmata presents several challenges that researchers must address:

  • Expression system optimization: While E. coli is commonly used for expressing the recombinant protein with an N-terminal His tag , optimizing expression conditions is critical to maintain protein functionality and prevent inclusion body formation.

  • Protein folding and stability: As a membrane protein native to thylakoid membranes, ensuring proper folding in a heterologous expression system requires careful buffer and solubilization agent selection.

  • Post-translational modifications: Any native post-translational modifications may be absent in recombinant systems, potentially affecting protein function and stability.

  • Storage and handling: Recombinant Photosystem Q(B) protein requires specific storage conditions (-20°C/-80°C) and should avoid repeated freeze-thaw cycles to maintain stability .

How does the digestibility of P. palmata proteins compare to reference proteins like casein?

In vitro digestibility studies have shown that P. palmata proteins are generally hydrolyzed to a limited extent compared to reference proteins like casein . The digestibility of protein samples is calculated using nitrogen digestibility (ND):

ND(%)=N in dialysate (mg)N in protein sample (40 mg)×100ND (\%) = \frac{N \text{ in dialysate (mg)}}{N \text{ in protein sample (40 mg)}} \times 100

When various enzymes (bovine trypsin, bovine chymotrypsin, pronase, or human intestinal juice) were tested, P. palmata proteins showed limited hydrolysis regardless of the enzyme used . Even after 120 minutes of incubation, there was only limited effect on the 10-30 kDa protein bands. This resistance to digestion may be due to structural features of the proteins or potentially post-translational modifications like glycosylation, although lectin blotting experiments with five lectins yielded negative results .

What are the recommended conditions for expression and purification of recombinant P. palmata Photosystem Q(B) protein?

For optimal expression and purification of recombinant P. palmata Photosystem Q(B) protein:

  • Expression system: The full-length protein (1-344 amino acids) can be expressed in E. coli with an N-terminal His tag .

  • Purification: Purification typically utilizes the His tag for affinity chromatography, with SDS-PAGE verification showing greater than 90% purity .

  • Storage buffer: The purified protein can be stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 or a Tris-based buffer with 50% glycerol optimized for the protein .

  • Storage conditions: Store at -20°C/-80°C for extended periods. For working aliquots, storage at 4°C for up to one week is acceptable. Repeated freeze-thaw cycles should be avoided .

  • Reconstitution: Prior to use, briefly centrifuge the vial to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

What methods are effective for analyzing the nitrogen and protein content in P. palmata?

Several methodologies have proven effective for analyzing nitrogen and protein content in P. palmata:

  • Total Nitrogen (TN) Determination: The macro-Kjeldahl protocol is commonly used to determine total nitrogen content in P. palmata samples. Results are typically expressed as percentage (g nitrogen/100 g dry weight biomass) .

  • Protein Nitrogen (PN) and Non-Protein Nitrogen (NPN) Analysis: These can be determined using protocols that separate protein and non-protein nitrogen fractions .

  • Protein Concentration Determination: The bicinchoninic acid (BCA) protein reagent assay can be used to determine protein concentration in solution, with Bovine Serum Albumin (BSA) as the protein standard .

  • Amino Acid Composition Analysis: Proteins from P. palmata can be hydrolyzed with 6 N HCl at 110°C for 24 hours, followed by high-performance liquid chromatography (HPLC) using a cation exchange column and ninhydrin derivation post-column .

  • SDS-PAGE Analysis: This technique is effective for analyzing protein extracts and monitoring changes in protein expression under different conditions .

How can researchers effectively analyze changes in Photosystem Q(B) protein expression under different light conditions?

To effectively analyze changes in Photosystem Q(B) protein expression under different light conditions, researchers can employ the following methodology:

  • Controlled light exposure: Culture P. palmata under different light regimes (white, red, blue, and green) using consistent intensity and duration parameters .

  • Sequential sampling: Collect samples at regular intervals (e.g., days 0, 6, and 12) to monitor temporal changes in protein expression .

  • Protein extraction: Extract proteins using standardized protocols that maintain protein integrity.

  • SDS-PAGE analysis: Perform SDS-PAGE on the protein extracts obtained from biomass collected after exposure to different light treatments .

  • Relative quantification: Conduct densitometric analysis of protein bands using imaging systems and software (such as Uvi-Tec imaging system and UViBand Essential Software). Express the relative protein content in individual bands as the percentage volume of each band in relation to the total volume of the initial sample .

  • Statistical analysis: Compare protein expression patterns across different light conditions and time points using appropriate statistical methods to identify significant differences.

How should researchers interpret variations in Photosystem Q(B) protein expression data between different experimental conditions?

When interpreting variations in Photosystem Q(B) protein expression data between different experimental conditions, researchers should consider:

What are the key considerations for experimental design when studying the effects of environmental factors on P. palmata protein expression?

When designing experiments to study environmental effects on P. palmata protein expression, researchers should consider:

  • Control conditions: Establish baseline measurements under standard conditions before introducing experimental variables. This includes characterizing the initial protein content and composition .

  • Parameter isolation: Design experiments to isolate individual environmental parameters (light quality, light intensity, temperature, nutrient concentration) to understand their specific impacts.

  • Sampling strategy: Implement a temporal sampling strategy that captures both short-term and long-term adaptations in protein expression. Research indicates significant changes occur by day 6 and continue through day 12 .

  • Sample replication: Perform analyses in triplicate for statistical validity, as demonstrated in previous research methodologies .

  • Method consistency: Use consistent methods for nitrogen and protein determination across all experimental conditions to ensure comparability.

  • Integrated analysis: Correlate protein expression changes with other parameters such as pigment composition or growth rate to understand the broader physiological response .

  • Seasonal considerations: If possible, conduct experiments across multiple seasons or account for seasonal variations in baseline protein content when interpreting results .

How can researchers compare the functional characteristics of recombinant versus native Photosystem Q(B) protein?

To effectively compare recombinant and native Photosystem Q(B) protein, researchers should implement a multi-faceted approach:

  • Structural comparisons:

    • Perform circular dichroism (CD) spectroscopy to compare secondary structure elements

    • Conduct limited proteolysis experiments to assess domain organization and accessibility

    • Compare thermal stability profiles using differential scanning calorimetry

  • Functional assays:

    • Assess electron transport capacity in reconstituted systems

    • Measure binding affinities for electron transport partners

    • Compare photochemical efficiency parameters

  • Post-translational modifications:

    • Identify and characterize any post-translational modifications in the native protein

    • Determine if these modifications affect function in the recombinant version

    • Consider expressing the protein in systems that can perform relevant modifications

  • Protein-protein interactions:

    • Compare the ability of both proteins to interact with physiological partners

    • Conduct pull-down assays or co-immunoprecipitation experiments

  • Membrane integration:

    • Assess the ability of the recombinant protein to properly integrate into thylakoid membranes

    • Compare detergent solubilization profiles of both proteins

  • Environmental response:

    • Compare how both proteins respond to changes in pH, ionic strength, and temperature

    • Determine if light-induced changes affect both proteins similarly

The methodological approach should include direct side-by-side comparisons under identical experimental conditions, with appropriate controls and statistical analysis to validate any observed differences.

What are promising strategies for improving recombinant expression yields of Photosystem Q(B) protein?

Several strategies show promise for improving recombinant expression yields of Photosystem Q(B) protein:

  • Alternative expression systems: While E. coli is commonly used , exploring eukaryotic expression systems like yeast or insect cells might provide better folding environments for this membrane protein.

  • Codon optimization: Customizing the coding sequence to match codon usage preferences of the expression host could significantly improve translation efficiency.

  • Fusion partners: Testing different fusion tags beyond the His-tag, such as MBP (maltose-binding protein) or SUMO, may enhance solubility and reduce inclusion body formation.

  • Chaperone co-expression: Co-expressing molecular chaperones with the target protein could improve folding efficiency and reduce aggregation.

  • Culture condition optimization: Systematic optimization of temperature, induction timing, and media composition could yield significant improvements in expression levels.

  • Directed evolution approaches: Applying directed evolution to generate variants with improved expression characteristics while maintaining functional properties.

  • Cell-free expression systems: These systems bypass cellular toxicity issues that might limit expression of membrane proteins and allow direct incorporation into artificial membrane systems.

How might the insights from P. palmata Photosystem Q(B) protein research impact our understanding of photosynthetic adaptations in red algae?

Research on P. palmata Photosystem Q(B) protein provides valuable insights into photosynthetic adaptations in red algae:

  • Light adaptation mechanisms: Understanding how this protein responds to different light conditions may reveal evolutionary adaptations that allow red algae to thrive in specific marine environments.

  • Stress response pathways: Characterizing how the protein structure and function change under various stress conditions could illuminate stress tolerance mechanisms unique to red algae.

  • Evolutionary perspectives: Comparing Photosystem Q(B) protein sequences and structures across different algal lineages may provide insights into the evolutionary history of photosynthetic systems.

  • Biotechnological applications: Knowledge gained could inform the development of algae-based technologies for sustainable energy production or environmental applications.

  • Climate change adaptation: Understanding how this critical photosynthetic protein responds to environmental changes may help predict how red algae populations will adapt to changing ocean conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.