Recombinant Pan paniscus ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Role

MT-ATP6 is a mitochondrially encoded subunit of the F₀ domain of ATP synthase. Key features include:

  • Domain: Integral membrane protein with two transmembrane helices and a hydrophilic loop .

  • Function: Forms part of the proton channel, enabling proton flow to drive ATP synthesis via rotational catalysis .

  • Assembly: Integrates into the F₀ sector alongside nuclear-encoded subunits (e.g., subunits b, c, and A6L) .

Subunit Composition of ATP Synthase Across Species

SpeciesMitochondrial Subunits (F₀)Nuclear-Encoded Subunits (F₁/F₀)Reference
Homo sapiensMT-ATP6, MT-ATP8ATP5A1, ATP5B, ATP5H, etc.
Bos taurusMT-ATP6 (P00847)ATP5F1, ATP5G1, ATP5E, etc.
S. cerevisiaeAtp6p, Atp8pAtp1p, Atp2p, Atp5p, etc.

Production of Recombinant MT-ATP6

Recombinant MT-ATP6 is typically expressed in heterologous systems like E. coli or yeast due to challenges in mitochondrial protein expression. For example:

  • Yeast Models: Saccharomyces cerevisiae has been engineered to express human MT-ATP6 variants, enabling functional studies .

  • Bovine Homolog: The bovine MT-ATP6 (UniProt: P00847) has been recombinantly produced for structural studies .

Key Steps in Recombinant Production

  1. Gene Cloning: MT-ATP6 is amplified and inserted into expression vectors.

  2. Expression: Host cells (e.g., yeast) are cultured under conditions inducing mitochondrial biogenesis.

  3. Purification: Affinity chromatography isolates the subunit using tags like His₆ .

Pathogenic Variants and Functional Deficits

Over 20 pathogenic MT-ATP6 variants are linked to mitochondrial disorders like Leigh syndrome and NARP (neuropathy, ataxia, retinitis pigmentosa) . Yeast models reveal mechanistic insights:

Pathogenic Variants and Biochemical Impact

VariantPhenotypeATP Synthesis DeficitMitochondrial Membrane PotentialReference
m.8993T>GNARP/Leigh syndromeSevere reductionIncreased
m.9185T>CLeigh syndromeModerate reductionDecreased
m.9025G>AAtaxia, muscle weakness60% of wild-typeNormal

Key Findings:

  • Proton Channel Disruption: Variants like m.8993T>G impair proton translocation, uncoupling ATP synthesis from the proton gradient .

  • Assembly Defects: Mutations in conserved residues (e.g., Gly167, His168) destabilize F₀-F₁ interactions .

Applications in Research

Recombinant MT-ATP6 is pivotal for:

  • Drug Screening: Testing inhibitors (e.g., oligomycin) targeting ATP synthase .

  • Disease Modeling: Yeast expressing human MT-ATP6 variants replicate biochemical deficits seen in patients .

  • Structural Studies: Cryo-EM resolves conformational changes during proton translocation .

Challenges and Future Directions

  • Species-Specific Differences: Pan paniscus MT-ATP6 may exhibit unique biochemical properties compared to human/bovine homologs.

  • Heteroplasmy Effects: Variable mutation load complicates phenotype-genotype correlations .

  • Therapeutic Development: Gene therapy or small-molecule correctors remain exploratory .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MNENLFASFAAPTILGLPAAVLIILFPPLLVPTSKHLINNRLITTQQWLIQLTSKQMMTM HNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVVMGFRFK TKNALAHFLPQGTPTPLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGSATLA LSTISLPSTLIIFTILILLTVLEIAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. This F-type ATPase comprises two domains: the extramembraneous catalytic core, F1, and the membrane proton channel, F0, linked by a central and peripheral stalk. ATP synthesis within F1's catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. A key component of the proton channel, subunit a may directly participate in proton translocation across the membrane.

Database Links

KEGG: pps:807880

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of MT-ATP6 in Pan paniscus?

MT-ATP6 is a mitochondrially encoded protein that functions as subunit a (or subunit 6) of the F0 complex within mitochondrial ATP synthase. In Pan paniscus, as in other species, this protein is embedded in the inner mitochondrial membrane and plays a crucial role in proton translocation. The protein weighs approximately 24.8 kDa and consists of 226 amino acids . MT-ATP6 forms part of the proton channel that allows H+ ions to flow across the inner mitochondrial membrane, which drives the rotary mechanism that enables ATP synthesis . The gene encoding this protein is located in mitochondrial DNA with a length of 681 base pairs, and notably has a 46-nucleotide overlap with the MT-ATP8 gene .

How does Pan paniscus MT-ATP6 differ from human MT-ATP6?

When studying recombinant Pan paniscus MT-ATP6, researchers should be aware that while highly conserved, there are subtle differences between bonobo and human versions that may impact experimental design. Both proteins maintain the same core function in ATP synthesis and similar structural features, but species-specific amino acid variations may affect antibody recognition, protein-protein interactions, and responses to inhibitors. For comparative studies, alignment analysis between human and Pan paniscus MT-ATP6 sequences should be performed prior to experimental design to identify these differences . These variations, while minor, can potentially influence membrane insertion dynamics and interactions with other subunits of the ATP synthase complex.

What methodologies are recommended for initial characterization of recombinant Pan paniscus MT-ATP6?

For initial characterization, researchers should employ a multi-faceted approach:

  • Protein expression verification: Western blotting with antibodies against conserved regions or epitope tags

  • Structural analysis: Circular dichroism to assess secondary structure

  • Functional assessment: ATP synthesis assays in reconstituted systems

  • Localization studies: Immunofluorescence microscopy to confirm membrane integration

Researchers should be particularly attentive to proper solubilization techniques as MT-ATP6 is highly hydrophobic. Detergents such as n-dodecyl β-D-maltoside (DDM) at 1-2% concentration have shown effectiveness for initial extraction while maintaining protein structure . For functional studies, the protein should be analyzed within the context of the complete ATP synthase complex rather than in isolation.

What expression systems are most effective for producing recombinant Pan paniscus MT-ATP6?

Production of functional recombinant MT-ATP6 presents significant challenges due to its hydrophobicity and mitochondrial origin. Research indicates that mammalian expression systems (particularly HEK293 or CHO cells) modified with mitochondrial-targeting sequences yield better results than prokaryotic systems . A methodological approach should include:

  • Codon optimization for the expression system

  • Addition of a cleavable mitochondrial targeting sequence

  • Use of inducible expression systems to minimize toxicity

  • Co-expression with chaperones to assist proper folding

The expression construct should be designed to include appropriate affinity tags (preferably at the C-terminus) for purification while ensuring these modifications don't interfere with protein folding or function. Expression levels should be monitored carefully as overexpression can lead to protein aggregation and impaired mitochondrial function .

What purification strategies address the hydrophobic nature of MT-ATP6?

Due to the highly hydrophobic nature of MT-ATP6, standard purification protocols often yield poor results. A recommended methodological workflow includes:

  • Initial extraction: Gentle solubilization using digitonin (1-2%) or DDM (0.5-1%) from isolated mitochondria or expression system membranes

  • Affinity chromatography: Using engineered tags (His, FLAG) under non-denaturing conditions

  • Size exclusion chromatography: To separate properly folded protein from aggregates

  • Quality control: Verification of structural integrity via circular dichroism and functional assays

Critical parameters to monitor include detergent concentration, salt conditions (typically 150-300 mM NaCl), and buffer pH (7.2-7.8). Throughout purification, samples should be maintained at 4°C to prevent aggregation, and reducing agents (such as 1-2 mM DTT) may be included to prevent oxidation of cysteine residues .

How can researchers assess the functional integrity of recombinant Pan paniscus MT-ATP6?

Functional integrity assessment requires evaluation of both integration into the ATP synthase complex and contribution to enzymatic activity. A comprehensive methodological approach includes:

  • Proton translocation assays: Using pH-sensitive fluorescent probes to measure proton movement across membranes containing reconstituted protein

  • ATP synthesis measurement: Luciferase-based assays to quantify ATP production rates

  • Membrane potential analysis: Using potential-sensitive dyes to assess ΔΨm maintenance

  • Complex assembly verification: Blue Native PAGE to confirm incorporation into the complete ATP synthase complex

For comparative analysis, wild-type human MT-ATP6 should be used as a reference standard. Experiments should include both positive controls (functional ATP synthase) and negative controls (known non-functional mutants or inhibitor-treated samples) . When analyzing data, researchers should focus on both absolute activity levels and the kinetic properties of ATP synthesis.

What approaches allow researchers to study MT-ATP6 interactions with other ATP synthase subunits?

To elucidate subunit interactions, researchers should employ multiple complementary techniques:

  • Crosslinking mass spectrometry: Using spacer-arm crosslinkers followed by proteolytic digestion and MS/MS analysis to identify interaction sites

  • Co-immunoprecipitation studies: With antibodies against MT-ATP6 or other subunits

  • FRET analysis: Using fluorescently labeled subunits to measure proximity in live systems

  • Computational modeling: Based on available structural data to predict interaction interfaces

When designing these experiments, researchers should consider the native membrane environment, as detergent solubilization may alter natural interaction patterns . The interaction between MT-ATP6 and MT-ATP8 is particularly important to investigate due to their gene overlap and functional relationship in the F0 sector of ATP synthase.

What methodologies are recommended for creating disease-relevant mutations in Pan paniscus MT-ATP6?

When studying disease-associated mutations, researchers should employ a systematic approach to ensure relevance and reproducibility:

  • Site-directed mutagenesis: Creating specific mutations corresponding to known pathogenic variants (m.8993T>G, m.8993T>C, m.9176T>C, and m.9185T>C are particularly significant)

  • Heteroplasmy modeling: Creating mixed populations with varying proportions of mutant and wild-type mtDNA

  • Validation of mitochondrial targeting: Confirming proper localization of mutant proteins

  • Functional assessment: Comparing ATP synthesis rates, proton translocation, and complex assembly

The heteroplasmy level is a critical parameter, as clinical studies show that disease severity correlates with mutation load, though not always linearly. Experiments should include heteroplasmy levels ranging from 20% to 100% to model the clinical spectrum observed in patients .

What cellular phenotypes should researchers monitor when studying MT-ATP6 mutations?

When investigating MT-ATP6 mutations, multiple cellular parameters should be assessed:

ParameterMeasurement MethodExpected Results with Pathogenic Mutations
ATP productionLuciferase assayDecreased output (typically 30-70% of normal)
Mitochondrial membrane potentialTMRM/JC-1 fluorescenceTypically hyperpolarized with some mutations
ROS productionDCF-DA, MitoSOXIncreased oxidative stress markers
Mitochondrial morphologyElectron microscopyAbnormal cristae, swelling
Cell viabilityMTT assay, Annexin VDecreased with high heteroplasmy
Mitochondrial calcium handlingCalcium-sensitive dyesDysregulated calcium homeostasis

Different mutations produce distinct bioenergetic profiles, with m.8993T>G typically causing more severe defects than m.8993T>C. Researchers should particularly note that some phenotypes may be cell-type specific, reflecting the tissue-specific manifestations of MT-ATP6 disorders .

How can comparative analysis between human and Pan paniscus MT-ATP6 inform evolutionary research?

Comparative analysis between human and bonobo MT-ATP6 provides valuable insights into mitochondrial evolution and adaptation. Methodological approaches should include:

  • Sequence alignment analysis: Identifying conserved vs. variable regions

  • Selective pressure analysis: Calculating dN/dS ratios to detect signatures of selection

  • Structural modeling: Predicting how species-specific variations affect protein structure

  • Functional complementation studies: Testing whether Pan paniscus MT-ATP6 can restore function in human MT-ATP6-deficient cell lines

What are the methodological challenges in comparing recombinant MT-ATP6 function across species?

Cross-species functional comparison presents several methodological challenges:

  • Nuclear-mitochondrial compatibility: MT-ATP6 functions within a complex predominantly composed of nuclear-encoded subunits

  • Mitochondrial genetic code variations: Potential differences in codon usage between species

  • Heteroplasmy considerations: Natural variation in mtDNA populations within individuals

  • Technical standardization: Ensuring comparable expression systems and measurement conditions

To address these challenges, researchers should use cybrid cell lines (cells with nuclear DNA from one species and mtDNA from another) or reconstituted systems with defined components from each species. Experimental results should be normalized against appropriate internal controls, and complementation assays should be performed to test functional equivalence between species variants .

How can researchers effectively study co-translational insertion of MT-ATP6?

The co-translational insertion of highly hydrophobic MT-ATP6 into the inner mitochondrial membrane presents unique research challenges. A methodological approach should include:

  • Pulse-chase experiments: Using radioactive amino acids to track protein synthesis and membrane integration

  • Ribosome profiling: To identify translation pauses that may facilitate membrane insertion

  • Analysis of insertion machinery: Investigation of OXA1L-mediated insertion processes

  • Quality control mechanisms: Study of AFG3L2 protease complex that resolves aberrant insertions

Recent research indicates that defects in OXA1L-mediated insertion of MT-ATP6 are rapidly resolved by the AFG3L2 protease complex, suggesting a sophisticated quality control system for this critical protein . When designing experiments, researchers should consider the temporal dynamics of synthesis, insertion, and quality control, as these processes occur on different timescales.

What approaches enable researchers to study MT-ATP6's role in ATP synthase dimerization and cristae formation?

The role of MT-ATP6 in ATP synthase dimerization and mitochondrial cristae formation represents an advanced research area. Methodological approaches include:

  • Blue Native PAGE: To analyze ATP synthase dimer/monomer ratios

  • Cryo-electron microscopy: To visualize dimer arrangements and cristae structure

  • Super-resolution microscopy: To analyze distribution patterns in intact mitochondria

  • Mutagenesis of interface residues: To identify regions crucial for dimerization

Mutations in MT-ATP6 can affect not only ATP synthesis but also mitochondrial morphology through altered dimerization properties. Researchers should employ both biochemical and imaging approaches, correlating structural changes with functional outcomes . The analysis should include quantification of cristae density, morphology, and ATP synthase distribution patterns along the cristae.

How can researchers apply single-molecule techniques to study MT-ATP6's role in the rotary mechanism of ATP synthase?

Single-molecule approaches offer unprecedented insights into the dynamic behavior of MT-ATP6 within the ATP synthase complex. A methodological framework includes:

  • Single-molecule FRET: Using fluorescently labeled subunits to track conformational changes

  • High-speed atomic force microscopy: To visualize rotational movements in real-time

  • Optical tweezers: To measure force generation during proton translocation

  • Nanodiscs reconstitution: Creating defined membrane environments for controlled studies

These techniques require careful experimental design, including strategic placement of fluorescent probes or handles that don't disrupt function. Data analysis should focus on identifying discrete states in the rotational cycle and correlating these with proton movement through the MT-ATP6 channel . Researchers should be aware that the time resolution of the chosen technique must match the kinetics of the biological process under study.

What methodologies allow researchers to investigate MT-ATP6's interaction with mitochondrial supercomplexes?

The potential role of ATP synthase (and specifically MT-ATP6) in supercomplex formation represents a frontier in mitochondrial research. Methodological approaches include:

  • Mild solubilization techniques: Using digitonin-based extraction to preserve supercomplex integrity

  • Clear Native PAGE: For separation of intact supercomplexes

  • Proximity labeling: Using engineered peroxidases (APEX2) to identify neighboring proteins

  • Quantitative proteomics: To measure stoichiometry changes under different conditions

Research should focus on how MT-ATP6 mutations affect not only ATP synthase function but potentially alter interactions with respiratory chain complexes. Experiments should be performed under different metabolic conditions (e.g., glucose vs. galactose media) to reveal context-dependent interactions . Analysis should include both structural assessment of supercomplex formation and functional measurements of respiratory efficiency.

How should researchers interpret heteroplasmy data when studying MT-ATP6 mutations?

Heteroplasmy (the coexistence of wild-type and mutant mtDNA) presents unique challenges for data interpretation. A methodological framework includes:

  • Accurate quantification: Using next-generation sequencing or digital droplet PCR for precise heteroplasmy measurement

  • Threshold effect analysis: Determining the critical mutation load that triggers dysfunction

  • Tissue-specific considerations: Accounting for potential tissue-specific segregation of mutant mtDNA

  • Temporal dynamics: Monitoring heteroplasmy changes during experimental timecourses

Clinical data indicate that the relationship between heteroplasmy and disease severity is not strictly linear. For instance, patients with m.8993T>G mutation at heteroplasmy levels between 70-90% may display a wide range of clinical phenotypes . Researchers should design experiments with multiple heteroplasmy levels and analyze data for potential threshold effects rather than assuming linear responses.

MutationDisease ThresholdTypical Cellular PhenotypeClinical Correlation
m.8993T>G~70-90%Severe ATP synthesis defectMILS/NARP syndrome
m.8993T>C~90-95%Moderate ATP synthesis defectMilder NARP phenotype
m.9176T>C~80-90%Variable ATP synthesis defectMILS/ataxia
m.9185T>C~80-90%Moderate ATP synthesis defectNARP/ataxia/MILS

This table represents typical thresholds based on clinical studies, but researchers should note that individual variability and nuclear genetic background can influence these thresholds .

What are the key considerations for designing valid control experiments when studying MT-ATP6?

Robust control design is essential for MT-ATP6 research. Methodological considerations include:

  • Isogenic controls: Using cell lines with identical nuclear background but different mtDNA

  • Rescue experiments: Complementation with wild-type MT-ATP6 to confirm phenotype specificity

  • Pharmacological controls: Using specific inhibitors (oligomycin) to mimic MT-ATP6 dysfunction

  • Technical controls: Including multiple measurement methods for key parameters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.