Recombinant Pan paniscus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pan paniscus Cytochrome c Oxidase Subunit 2 (MT-CO2)

Recombinant Pan paniscus Cytochrome c oxidase subunit 2 (MT-CO2) refers to a genetically engineered version of the cytochrome c oxidase subunit 2 protein, derived from the bonobo (Pan paniscus). This protein is a crucial component of the mitochondrial respiratory chain, specifically Complex IV, which plays a vital role in cellular respiration by facilitating the transfer of electrons from cytochrome c to oxygen, ultimately producing ATP. The recombinant form of MT-CO2 is produced through genetic engineering techniques, allowing for its expression in various host organisms for research and potential therapeutic applications.

Structure and Function of MT-CO2

Cytochrome c oxidase is composed of multiple subunits, with subunit 2 (MT-CO2) being one of the three mitochondrial DNA-encoded subunits. This subunit is essential for the proper functioning of the enzyme, as it contributes to the formation of the active site where oxygen is reduced to water. The structure of MT-CO2 includes several key amino acid residues that are crucial for its interaction with other subunits and for its catalytic activity.

SubunitEncodingFunction
MT-CO2Mitochondrial DNAEssential for enzyme activity and oxygen reduction

Research Findings and Applications

While specific research on recombinant Pan paniscus MT-CO2 is limited, studies on cytochrome c oxidase subunits in general highlight their importance in understanding mitochondrial function and disease. Mutations in mitochondrial-encoded subunits, including MT-CO2, can lead to mitochondrial disorders characterized by impaired energy production . Recombinant forms of these proteins can be used to study disease mechanisms and develop therapeutic strategies.

ApplicationDescription
Disease ModelingRecombinant MT-CO2 can be used to model mitochondrial disorders in vitro.
Therapeutic DevelopmentUnderstanding the function of MT-CO2 can aid in developing treatments for mitochondrial diseases.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MAHAAQVGLQDATSPIMEELIIFHDHALMIIFLICFLVLYALFLTLTTKLTNTSISDAQE METVWTILPAIILVLIALPSLRILYMTDEVNDPSFTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLEPGDLRLLDVDNRLVLPVEAPVRMMITSQDVLHSWAVPTLGLKTDAIPGRLN QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. MT-CO2 plays a crucial role in this process. Within Complex IV, it contributes to the electron transfer pathway, specifically involving the dinuclear copper A center (CuA) and heme A, ultimately facilitating the reduction of oxygen to water at the binuclear center (BNC) composed of heme a3 and copper B (CuB). This reduction requires four electrons from cytochrome c and four protons from the mitochondrial matrix.

Database Links

KEGG: pps:807874

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of cytochrome c oxidase subunit 2 in cellular respiration?

Cytochrome c oxidase subunit 2 (MT-CO2) is a critical component of complex IV in the mitochondrial electron transport chain that drives oxidative phosphorylation. It functions specifically in the initial transfer of electrons from cytochrome c to the cytochrome c oxidase complex. The protein contains a dinuclear copper A center (CU(A)) that receives electrons from reduced cytochrome c in the intermembrane space. These electrons are then transferred via heme A of subunit 1 to the active site binuclear center formed by heme A3 and copper B, where molecular oxygen is reduced to water using electrons from cytochrome c and protons from the mitochondrial matrix . This process contributes to creating the electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis, making it essential for cellular energy production.

What are the common challenges in expressing recombinant MT-CO2 in expression systems?

Expressing recombinant mitochondrial proteins like MT-CO2 presents several methodological challenges. As MT-CO2 is normally localized to the mitochondrial inner membrane with transmembrane regions (positions 15-45 and 60-87 in humans), proper folding and membrane insertion are critical considerations . Expression systems must account for the protein's hydrophobic nature and need for specific lipid environments. Additionally, MT-CO2 contains copper-binding sites crucial for electron transfer function, requiring expression conditions that support proper metal incorporation. Researchers should consider using specialized expression vectors with mitochondrial targeting sequences and host cells with robust mitochondrial function. Optimization of expression conditions, including temperature, induction parameters, and host cell selection, is essential to balance protein yield with proper folding and function.

How can selective pressure analysis be applied to understand the evolution of MT-CO2 in Pan paniscus compared to other great apes?

Selective pressure analysis of MT-CO2 can be approached using maximum likelihood models of codon substitution to calculate the ratio of nonsynonymous to synonymous substitutions (ω or dN/dS). This methodology has revealed that most COII codons are under strong purifying selection (ω << 1), reflecting the critical functional role of this protein in cellular respiration . To apply this approach to Pan paniscus MT-CO2:

  • Sequence acquisition: Obtain complete MT-CO2 sequences from Pan paniscus and other great apes (human, chimpanzee, gorilla, orangutan)

  • Sequence alignment: Create a codon-based multiple sequence alignment

  • Phylogenetic analysis: Construct a phylogenetic tree representing the evolutionary relationships

  • Selection analysis: Apply site-specific models (M0, M1a, M2a, M7, M8) using PAML or similar software

  • Branch-site analysis: Test for positively selected sites specifically in the Pan paniscus lineage

This approach can identify specific codons under positive selection that may reflect adaptive evolution in bonobos. Special attention should be paid to the amino terminal end of the protein, which shows increased variation in higher primates, and positions 114-115, where replacements of carboxyl-bearing residues (glutamate and aspartate) have been identified as potentially significant for enzyme kinetics in cross-reactions between cytochromes and cytochrome oxidases of higher primates and other mammals .

What experimental approaches can be used to study the interaction between recombinant Pan paniscus MT-CO2 and cytochrome c?

Studying the interaction between recombinant Pan paniscus MT-CO2 and cytochrome c requires specialized techniques that account for the membrane-bound nature of MT-CO2 and the electron transfer function of this interaction. A comprehensive experimental approach would include:

  • Protein preparation:

    • Express and purify recombinant Pan paniscus MT-CO2 with proper folding and copper incorporation

    • Source or express cytochrome c (ideally from Pan paniscus for native interactions)

  • Binding affinity studies:

    • Surface plasmon resonance (SPR) with MT-CO2 immobilized in a lipid environment

    • Isothermal titration calorimetry (ITC) to measure thermodynamic parameters

    • Microscale thermophoresis for solution-based interaction measurements

  • Functional analysis:

    • Electron transfer kinetics using stopped-flow spectroscopy

    • Oxygen consumption assays in reconstituted systems

    • Cytochrome c oxidation rates with varying substrate concentrations

  • Structural studies:

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Cryo-electron microscopy of the complex in a membrane environment

    • Cross-linking mass spectrometry to identify proximity relationships

This multi-method approach allows for complementary data on both the physical interaction and functional consequences of MT-CO2 binding to cytochrome c, providing insights into species-specific aspects of this crucial electron transport chain interaction.

How does evolutionary rate heterogeneity in MT-CO2 affect cross-species functional studies?

Evolutionary rate heterogeneity in MT-CO2 presents significant methodological considerations for cross-species functional studies. Research has demonstrated that higher primates (monkeys and apes) have undergone a nearly two-fold increase in amino acid replacement rates relative to other primates . This heterogeneity affects:

  • Functional compatibility: The replacement of carboxyl-bearing residues (glutamate and aspartate) at positions 114-115 may explain poor enzyme kinetics in cross-reactions between the cytochromes c and cytochrome c oxidases of higher primates and other mammals . When designing cross-species studies, researchers should account for these functional differences by:

    • Experimentally determining electron transfer rates between proteins from different species

    • Creating a compatibility matrix based on key residue differences

    • Using site-directed mutagenesis to test the impact of specific substitutions

  • Phylogenetic inference: Rate heterogeneity can confound phylogenetic analyses. Researchers should:

    • Apply models that account for variable rates across lineages

    • Partition analyses based on functional domains

    • Use relative rate tests to identify lineages with accelerated evolution

  • Expression system selection: When expressing recombinant Pan paniscus MT-CO2 for functional studies:

    • Consider using primate cell lines for more native post-translational modifications

    • Ensure compatible partner proteins (e.g., other COX subunits) if studying the assembled complex

    • Test functionality with both conspecific and heterospecific interaction partners

These considerations are essential for valid interpretation of experimental results and avoiding artifacts caused by evolutionary divergence.

What controls are essential when designing experiments with recombinant Pan paniscus MT-CO2?

When designing experiments with recombinant Pan paniscus MT-CO2, implementing appropriate controls is critical for valid interpretation of results. Based on experimental design principles, researchers should include:

  • Negative controls:

    • No-template controls in expression systems

    • Heat-denatured MT-CO2 to confirm activity is protein-specific

    • MT-CO2 with copper-binding sites mutated to demonstrate specificity of electron transfer function

  • Positive controls:

    • Well-characterized human MT-CO2 with known activity parameters

    • Commercial cytochrome c oxidase complex with established kinetics

    • Native Pan paniscus mitochondrial preparations (if available)

  • Experimental controls:

    • Expression tag-only proteins to control for tag interference

    • Wild-type and mutant variants to establish structure-function relationships

    • Time-course sampling to establish reaction kinetics and stability

  • Cross-species controls:

    • MT-CO2 from multiple primate species to account for evolutionary rate heterogeneity

    • Complementary cytochrome c from conspecific and heterospecific sources to test interaction specificity

Each experiment should be designed to systematically and precisely manipulate the independent variable(s), precisely measure the dependent variable(s), and control any potential confounding variables . For example, when measuring electron transfer activity, temperature, pH, and ionic strength should be carefully controlled across all experimental conditions.

How should researchers design experiments to assess the impact of specific amino acid substitutions in Pan paniscus MT-CO2?

Assessing the impact of specific amino acid substitutions in Pan paniscus MT-CO2 requires a carefully structured experimental approach:

  • Substitution selection strategy:

    Focus AreaSelection CriteriaValidation Approach
    Functional domainsConserved residues in copper-binding sitesSpectroscopic analysis of metal coordination
    Species-specific sitesPositions with evidence of positive selectionComparative kinetics with human MT-CO2
    Interface residuesAmino acids at cytochrome c binding interfaceBinding affinity measurements
    Transmembrane regionsResidues in membrane-spanning domainsMembrane insertion efficiency assessment
  • Experimental design approach:

    • Implement a randomized block design where each mutation variant is tested across multiple experimental conditions

    • Use site-directed mutagenesis to create single and combined mutations

    • Create a gradient of conservative to non-conservative substitutions at key positions

    • Include reversion mutations (substituting Pan paniscus residues with human counterparts)

  • Functional assessment methodology:

    • Electron transfer kinetics using stopped-flow spectroscopy

    • Protein stability assessment through thermal shift assays

    • Binding affinity determination via surface plasmon resonance

    • Assembly efficiency into functional complex IV

  • Data analysis framework:

    • Establish clear threshold values for functional significance

    • Perform multiple comparisons with appropriate statistical corrections

    • Create structure-function relationship models based on mutation effects

    • Correlate experimental findings with evolutionary conservation patterns

This experimental design systematically varies the independent variable (amino acid composition) while precisely measuring dependent variables (functional parameters) and controlling confounding variables such as protein expression levels and assay conditions .

What are the best expression systems for producing functional recombinant Pan paniscus MT-CO2?

Selection of an appropriate expression system for functional recombinant Pan paniscus MT-CO2 requires careful consideration of the protein's membrane-associated nature and complex cofactor requirements:

  • Mammalian expression systems:

    • HEK293 or CHO cells provide mammalian post-translational modifications

    • Primate cell lines may offer more native processing environment

    • Advantages: Proper membrane targeting, potential for co-expression with other subunits

    • Limitations: Lower yields, higher cost, longer production times

  • Insect cell expression:

    • Baculovirus-infected Sf9 or High Five cells

    • Advantages: Higher yield than mammalian systems, eukaryotic processing

    • Limitations: Differences in membrane composition, may affect copper incorporation

  • Bacterial expression with optimization:

    • E. coli strains engineered for membrane protein expression (C41/C43)

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Advantages: High yield, economical, rapid production

    • Limitations: Refolding often required, limited post-translational modifications

  • Cell-free expression systems:

    • Wheat germ extract supplemented with lipid nanodiscs

    • E. coli extract with supplemented chaperones

    • Advantages: Direct incorporation into membrane mimetics, rapid optimization

    • Limitations: Scaled production challenges, higher cost

Optimal expression conditions for each system should be determined experimentally, with careful attention to temperature, induction parameters, and copper supplementation. For membrane incorporation, consider co-expression with cytochrome c oxidase subunit 1 or reconstitution into nanodiscs or liposomes. Expression success should be evaluated not only by protein yield but also by functional activity in electron transfer assays.

How can researchers distinguish between natural variation and experimental artifacts when analyzing MT-CO2 sequence data from Pan paniscus populations?

Distinguishing between natural variation and experimental artifacts in MT-CO2 sequence data requires a systematic analytical approach:

  • Sequencing quality control framework:

    Quality ParameterAcceptance ThresholdMitigation Strategy
    Base quality scoresPhred score >30Trim low-quality bases
    Coverage depthMinimum 30XIncrease sequencing depth for low-coverage regions
    Strand biasBalanced representationFlag positions with significant bias
    Alignment qualityMapping quality >40Use MT-CO2-specific alignment parameters
  • Variation validation strategy:

    • Replicate sequencing from independent DNA extractions

    • Use multiple sequencing technologies (Illumina, PacBio, Oxford Nanopore)

    • Validate variants with alternative methods (e.g., Sanger sequencing for key positions)

    • Compare with published Pan paniscus sequences from different populations

  • Distinguishing characteristics of natural variation:

    • Phylogenetic consistency with related taxa

    • Variation patterns consistent with selective constraints (e.g., higher diversity in less conserved regions)

    • Population genetic signatures (e.g., site frequency spectrum consistent with expected patterns)

    • Absence of sequence context biases (e.g., homopolymer-associated errors)

  • Statistical approach:

    • Apply error models specific to sequencing technology

    • Implement Bayesian variant calling with appropriate priors

    • Calculate false discovery rates based on technical replicates

    • Perform comparative analyses with other mitochondrial genes as internal controls

This approach is particularly important given that previous studies have found virtually no intrapopulation divergence in COII in other species, while interpopulation divergence can be significant . Therefore, unexpected high levels of intrapopulation variation might indicate technical artifacts rather than biological variation.

What statistical approaches are most appropriate for analyzing evolutionary rate heterogeneity in MT-CO2 across primate lineages?

Analyzing evolutionary rate heterogeneity in MT-CO2 across primate lineages requires specialized statistical approaches that account for the complexity of molecular evolution:

  • Likelihood ratio tests for selection analysis:

    • Compare nested models of codon evolution (e.g., M1a vs. M2a, M7 vs. M8)

    • Test for branch-specific rate acceleration using branch models

    • Implement branch-site models to identify positively selected sites in specific lineages

    • Calculate Bayes Empirical Bayes (BEB) posterior probabilities for site-specific selection

  • Relative rate tests:

    • Tajima's relative rate test for sequence triplets

    • Likelihood ratio tests for local clock models

    • Bayesian approaches comparing evolutionary rates across lineages

    • Window-based analyses to identify domains with heterogeneous rates

  • Phylogenetic comparative methods:

    • PGLS (Phylogenetic Generalized Least Squares) for correlating evolutionary rates with species traits

    • Ancestral state reconstruction to trace the history of key amino acid changes

    • Tests for correlated evolution between MT-CO2 and interacting proteins (e.g., cytochrome c)

    • Disparity analysis to quantify rate variation across the primate phylogeny

  • Advanced modeling approaches:

    • Mixed-effects models incorporating both fixed phylogenetic effects and random rate variation

    • Bayesian relaxed clock models (e.g., BEAST analysis with uncorrelated lognormal relaxed clock)

    • Covarion models to account for shifting selective constraints

    • Mechanistic models incorporating protein structure and function

These statistical approaches are essential for robustly testing hypotheses about the accelerated evolution observed in higher primates, where monkeys and apes have undergone a nearly two-fold increase in the rate of amino acid replacement relative to other primates . Particular attention should be paid to the amino terminal end of the protein, which shows increased variation, and to specific functionally important positions like the carboxyl-bearing residues at positions 114-115.

How should researchers interpret functional differences between recombinant and native MT-CO2 in experimental contexts?

Interpreting functional differences between recombinant and native MT-CO2 requires careful consideration of multiple factors that could influence protein behavior:

  • Expression system effects:

    • Post-translational modifications may differ between recombinant and native contexts

    • Membrane composition in expression systems affects protein folding and activity

    • Expression tags can interfere with function even after cleavage

    • Recombinant protein may lack proper assembly with other cytochrome oxidase subunits

  • Systematic analysis framework:

    ParameterMeasurement ApproachInterpretation Guideline
    Electron transfer kineticsStopped-flow spectroscopyCompare kcat/Km values directly
    Copper contentAtomic absorption spectroscopyNormalize activity to metal content
    Protein stabilityThermal shift assaysConsider activity within physiological temperature range
    Membrane integrationProtease protection assaysAssess proper topology before functional comparisons
  • Benchmarking strategy:

    • Compare recombinant proteins from different expression systems

    • Establish activity ratios rather than absolute values

    • Use human MT-CO2 as a reference standard

    • Create chimeric constructs to identify regions responsible for functional differences

  • Interpretation framework:

    • Establish clear criteria for biologically significant differences

    • Consider the protein's natural context in the respiratory chain complex

    • Account for species-specific interaction partners

    • Distinguish between artifacts and true functional specialization

This methodological approach acknowledges that some differences between recombinant and native proteins are inevitable but provides a framework for distinguishing technical artifacts from biologically meaningful variations. Since MT-CO2 functions as part of a multisubunit complex in the mitochondrial inner membrane , both its individual properties and its interactions with other components must be considered when interpreting functional data.

How does the evolution of MT-CO2 in Pan paniscus compare to other mitochondrial-encoded proteins?

The evolutionary pattern of MT-CO2 in Pan paniscus and other great apes shows distinctive characteristics compared to other mitochondrial-encoded proteins:

Understanding the comparative evolution of MT-CO2 provides insights into the selective pressures shaping the mitochondrial genome in Pan paniscus and aids in interpreting the functional significance of species-specific variations.

What can MT-CO2 sequences tell us about Pan paniscus population structure and evolutionary history?

MT-CO2 sequences can provide valuable insights into Pan paniscus population structure and evolutionary history through several analytical approaches:

  • Population genetic analysis:

    • Haplotype diversity analysis to identify population substructure

    • Neutrality tests (Tajima's D, Fu's Fs) to detect demographic events or selection

    • Mismatch distribution analysis to infer population expansion events

    • Isolation-by-distance testing to examine geographical patterns

  • Phylogeographic inference:

    • Construct haplotype networks to visualize relationships between populations

    • Bayesian phylogeographic analysis to reconstruct historical migrations

    • Divergence time estimation between Pan paniscus populations

    • Comparative analysis with other bonobo mitochondrial regions to identify concordant patterns

  • Comparative analysis with Pan troglodytes (chimpanzee):

    • MT-CO2 sequence divergence provides insights into the timing of bonobo-chimpanzee divergence

    • Analysis of lineage-specific substitutions identifies potential adaptive changes

    • Comparison of intraspecific diversity patterns reveals differences in effective population sizes

    • Study of incomplete lineage sorting informs understanding of the Pan genus evolution

  • Conservation implications:

    • Identification of genetic units for conservation prioritization

    • Assessment of genetic diversity to evaluate population viability

    • Detection of population bottlenecks or expansions

    • Recognition of unique evolutionary lineages within Pan paniscus

These analyses should consider the characteristics of mitochondrial markers, including maternal inheritance and lack of recombination. When interpreting MT-CO2 data for population studies, researchers should also be aware that strong functional constraints may limit variation, as studies in other species have found virtually no intrapopulation divergence in COII gene sequences . Therefore, integrating MT-CO2 data with other genetic markers provides a more comprehensive understanding of Pan paniscus evolutionary history.

What are the future research directions for Pan paniscus MT-CO2 studies?

Future research on Pan paniscus MT-CO2 offers several promising directions that integrate evolutionary biology, biochemistry, and conservation:

  • Functional genomics approaches:

    • CRISPR-mediated introduction of Pan paniscus MT-CO2 variants into cellular models

    • Investigation of mitonuclear compatibility between Pan paniscus MT-CO2 and human nuclear genes

    • Comprehensive characterization of electron transfer kinetics across great ape MT-CO2 variants

    • Development of Pan paniscus-specific mitochondrial function assays

  • Structural biology advances:

    • Cryo-EM structures of Pan paniscus respiratory chain complexes

    • Molecular dynamics simulations comparing human and Pan paniscus MT-CO2

    • Hydrogen-deuterium exchange mass spectrometry to map species-specific conformational dynamics

    • Integration of structural data with evolutionary analyses to identify functionally significant substitutions

  • Population genomics extensions:

    • Whole mitochondrial genome sequencing across Pan paniscus populations

    • Integration of nuclear and mitochondrial markers for comprehensive evolutionary analysis

    • Investigation of potential adaptive introgression events in MT-CO2

    • Development of non-invasive methods for mitochondrial DNA recovery from endangered populations

  • Translational applications:

    • Comparative studies of mitochondrial disorders affecting MT-CO2 function

    • Investigation of species-specific responses to mitochondrial toxins

    • Exploration of Pan paniscus MT-CO2 as a model for human mitochondrial function

    • Development of cross-species electron transport chain compatibility metrics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.