Recombinant Pan paniscus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MNFVLILMTNTLLALLLMIITFWLPQLNSYMEKSNPYECGFDPMSPARVPFSMKFFLVAI TFLLFDLEIALLLPLPWALQTANLPLMVMSSLLLITILALSLAYEWLQKGLDWAE
Uniprot No.

Target Background

Function

A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This enzyme catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor. MT-ND3 is essential for the catalytic activity of Complex I.

Database Links

KEGG: pps:807879

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of MT-ND3 in mitochondrial function?

MT-ND3 (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 3) functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This complex catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. MT-ND3 is essential for the catalytic activity of Complex I, playing a critical role in cellular energy production through oxidative phosphorylation . The protein enables NADH dehydrogenase (ubiquinone) activity and is fundamentally involved in the electron transport chain that generates ATP within mitochondria . In Pan paniscus, as in other primates, this protein maintains high conservation of functional domains despite some species-specific variations.

How does MT-ND3 structure relate to its function in Complex I?

MT-ND3 is a relatively small protein (typically 115 amino acids in mammals) that forms part of the membrane domain of Complex I. The protein contains multiple transmembrane helices that anchor it within the mitochondrial inner membrane . These structural elements position MT-ND3 at a critical junction within Complex I where it contributes to proton pumping and electron transfer mechanisms. The protein's structure directly impacts its ability to participate in Complex I assembly and stability. Alterations to key amino acid residues can disrupt protein-protein interactions within the complex, leading to decreased assembly efficiency and reduced enzymatic activity, as observed in variants such as m.10197G > C .

What genomic characteristics define MT-ND3 in Pan paniscus compared to humans?

The MT-ND3 gene in Pan paniscus, like in Homo sapiens, is encoded by the mitochondrial genome rather than nuclear DNA. Comparative genomic analyses have revealed that while the gene maintains high sequence conservation across primates, there are notable differences in patterns of variation. Within-species variation in both humans and chimpanzees shows a higher ratio of replacement to silent nucleotide substitutions compared to between-species differences . This pattern suggests that slightly deleterious polymorphisms may exist in the mitochondrial genes of both species but are eventually removed by purifying selection over evolutionary time . The specific nucleotide and amino acid differences between human and Pan paniscus MT-ND3 reflect approximately 1-2 million years of evolutionary divergence.

What are the optimal expression systems for producing recombinant Pan paniscus MT-ND3?

For recombinant expression of MT-ND3 from Pan paniscus, E. coli-based expression systems have proven successful, as demonstrated with other mammalian MT-ND3 proteins . When designing expression systems, researchers should consider:

  • Codon optimization for the host expression system

  • Addition of purification tags (typically His-tag at N-terminal position)

  • Use of specialized E. coli strains that facilitate membrane protein expression

  • Growth at lower temperatures (16-25°C) to enhance proper folding

  • Induction protocols with reduced IPTG concentrations

For example, as seen with other mammalian MT-ND3 proteins, successful expression has been achieved using E. coli with an N-terminal His-tag fusion . The expressed protein should be purified under conditions that maintain its native conformation, typically using detergent solubilization followed by affinity chromatography. Notably, alternative expression systems such as yeast or insect cells may provide better folding environments for this mitochondrial membrane protein.

How can researchers verify the functional integrity of recombinant MT-ND3?

Verifying functional integrity of recombinant Pan paniscus MT-ND3 requires multiple complementary approaches:

Assessment MethodParameters MeasuredTechnical Considerations
Complex I Assembly AnalysisIntegration into Complex I structureBlue Native PAGE; antibody detection
NADH:Ubiquinone Oxidoreductase ActivityElectron transfer ratesSpectrophotometric assays measuring NADH oxidation
ATP Synthesis MeasurementEnergy production capacityLuciferase-based ATP quantification
Membrane Potential AnalysisProton gradient formationPotential-sensitive fluorescent probes
Protein-Protein Interaction StudiesAssociation with other Complex I subunitsCo-immunoprecipitation; proximity ligation assays

Researchers should particularly focus on comparing the recombinant protein's activity to native MT-ND3 isolated from Pan paniscus mitochondria when possible . Complex I assembly and activity assays are especially critical, as they directly reflect the protein's ability to perform its biological function within the respiratory chain .

What methodological approaches can resolve challenges in MT-ND3 crystallization for structural studies?

Obtaining high-resolution structural data for MT-ND3 presents significant challenges due to its hydrophobic nature and tendency to aggregate. Researchers should consider:

  • Lipid cubic phase crystallization techniques that better stabilize membrane proteins

  • Detergent screening to identify optimal solubilization conditions

  • Use of antibody fragments or nanobodies to stabilize specific conformations

  • Cryo-electron microscopy as an alternative to crystallography

  • Construct design with fusion partners that enhance solubility

Recent advances have shown that determining MT-ND3 structure within the context of the entire Complex I may be more successful than attempting to crystallize the isolated subunit. Researchers should consider using recombinant Pan paniscus MT-ND3 incorporated into purified Complex I preparations from the same species to maintain native interactions . Alternative approaches include computational modeling based on homologous proteins with known structures.

How do nucleotide substitution patterns in MT-ND3 inform our understanding of primate evolution?

Analysis of MT-ND3 sequences across primates reveals important evolutionary patterns. In both humans and chimpanzees (including Pan paniscus), the ratio of replacement to silent nucleotide substitutions within species is higher than observed between species . This pattern contradicts neutral evolution expectations and suggests that slightly deleterious mutations may persist as polymorphisms within species but are eventually eliminated by natural selection over evolutionary time .

Methodologically, researchers should:

  • Sequence the complete MT-ND3 gene from multiple individuals within each species

  • Calculate Ka/Ks ratios (nonsynonymous/synonymous substitution rates)

  • Apply appropriate statistical models to test for selection

  • Compare patterns across multiple mitochondrial genes to identify gene-specific trends

  • Correlate observed patterns with functional domains within the protein

These analyses of MT-ND3 contribute to broader understanding of mitochondrial genome evolution in primates and can reveal signatures of adaptation versus constraint in energy metabolism pathways across closely related species .

What evidence exists for functional adaptation of MT-ND3 in Pan paniscus compared to Pan troglodytes and Homo sapiens?

Comparative analysis of MT-ND3 across Pan paniscus (bonobo), Pan troglodytes (common chimpanzee), and Homo sapiens reveals subtle but potentially significant functional adaptations. While evidence from the literature is still emerging, research approaches should include:

  • Functional assays comparing enzyme kinetics across species

  • Thermal stability measurements of the proteins under various conditions

  • Respiration studies in cell lines expressing species-specific variants

  • Molecular dynamics simulations to predict functional effects of amino acid differences

  • Analysis of interactions with nuclear-encoded Complex I subunits from each species

The patterns observed in human and chimpanzee MT-ND3 suggest that species-specific adaptations may exist . These adaptations could reflect differences in metabolic demands, environmental pressures, or co-evolution with nuclear genes. Methodologically, researchers should employ comparative biochemistry approaches using recombinant proteins from each species to directly measure functional parameters.

How do disease-causing mutations in MT-ND3 affect Complex I assembly and function?

Pathogenic mutations in MT-ND3 significantly impact Complex I assembly and function, leading to mitochondrial diseases. For example, the m.10197G > C variant in MT-ND3 causes significantly lowered MT-ND3 protein levels, resulting in complex I assembly and activity deficiency, and reduced ATP synthesis . Other variants like m.10191T > C are known to cause Leigh syndrome or mitochondrial complex I deficiency .

These mutations typically affect:

  • Protein stability and abundance

  • Complex I assembly efficiency

  • NADH dehydrogenase activity

  • Proton pumping capacity

  • ROS (reactive oxygen species) production

What therapeutic approaches show promise for addressing MT-ND3-related mitochondrial disorders?

Recent research has identified promising therapeutic approaches for MT-ND3-related disorders. One significant breakthrough involves allotopic expression - delivering mitochondrial genes into mitochondria through codon optimization for nuclear expression and translation by cytoplasmic ribosomes .

The methodology includes:

  • Codon optimization of the MT-ND3 gene for nuclear expression

  • Addition of mitochondrial targeting sequences

  • Construction of expression vectors for cellular delivery

  • Evaluation of mitochondrial import efficiency

  • Assessment of functional rescue through Complex I activity and ATP production measurements

This approach has shown success in partially restoring protein levels, complex I deficiency, and ATP production in patients with m.10197G > C and m.10191T > C variants in MT-ND3 . For researchers working with Pan paniscus MT-ND3, these techniques could be adapted to study the rescue of artificially introduced mutations that mimic human disease variants, providing valuable comparative data on mitochondrial disease mechanisms across primates.

How does nuclear-mitochondrial genomic crosstalk influence MT-ND3 expression and function?

The interplay between nuclear and mitochondrial genomes critically influences MT-ND3 expression and function. While MT-ND3 is encoded by mitochondrial DNA, its functional integration into Complex I requires coordination with nuclear-encoded subunits. Research approaches to study this crosstalk include:

  • Analysis of species-specific compatibility between nuclear and mitochondrial genomes

  • Investigation of nuclear factors that regulate MT-ND3 transcription and translation

  • Study of post-translational modifications of MT-ND3 by nuclear-encoded enzymes

  • Examination of retrograde signaling from mitochondria to nucleus in response to MT-ND3 dysfunction

  • Development of cybrid cell lines containing Pan paniscus mitochondria in human nuclear backgrounds

This research area is particularly relevant when studying recombinant MT-ND3, as the protein's function in isolation may differ from its behavior in the context of complete mitochondrial systems. Methodologically, researchers should consider complementation studies where recombinant Pan paniscus MT-ND3 is introduced into cells lacking functional MT-ND3 to assess interspecies compatibility of mitochondrial-nuclear interactions .

What techniques can accurately assess the impact of MT-ND3 variants on ROS production and oxidative stress?

Assessing the impact of MT-ND3 variants on reactive oxygen species (ROS) production requires sophisticated methodological approaches:

TechniqueMeasurement CapabilityAdvantagesLimitations
Fluorescent Probes (DCF, MitoSOX)Real-time ROS detectionCellular localization; live cell imagingPotential artifacts; probe specificity
Electron Paramagnetic ResonanceDirect detection of free radicalsHigh specificity; quantitativeComplex sample preparation; specialized equipment
Protein Carbonylation AssaysOxidative damage to proteinsMeasures functional consequences of ROSIndirect measure; potential for false positives
Lipid Peroxidation AnalysisMembrane damage assessmentReflects physiological impactDownstream consequence rather than direct measurement
Antioxidant Enzyme ActivityCellular response to oxidative stressIndicates adaptive mechanismsInfluenced by multiple factors beyond MT-ND3

For Pan paniscus MT-ND3 research, comparing ROS production between wild-type and variant forms requires careful experimental design with appropriate controls. Researchers should consider using cybrid cell lines or reconstituted systems where the only variable is the MT-ND3 protein sequence . This approach helps isolate the specific contribution of MT-ND3 variants to ROS generation and subsequent oxidative stress.

How can researchers effectively model the integration of recombinant MT-ND3 into existing Complex I structures?

Modeling the integration of recombinant Pan paniscus MT-ND3 into existing Complex I structures presents significant challenges that require advanced computational and experimental approaches:

  • Homology modeling based on existing Complex I structures from closely related species

  • Molecular dynamics simulations to predict stable integration conformations

  • Cross-linking mass spectrometry to identify interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry to assess structural dynamics

  • Cryo-electron microscopy of reconstituted complexes containing recombinant MT-ND3

Successful modeling requires integration of structural data with functional assays to validate predictions. Researchers should particularly focus on the interaction interfaces between MT-ND3 and adjacent subunits within Complex I . When working with Pan paniscus MT-ND3, comparative modeling with human and common chimpanzee structures can highlight species-specific structural adaptations that may influence assembly efficiency or complex stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.