Recombinant Pan paniscus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

As a subunit of mitochondrial Complex I (NADH dehydrogenase), MT-ND6 facilitates electron transfer from NADH to ubiquinone (CoQ10), driving proton pumping across the mitochondrial inner membrane to support ATP synthesis . Key mechanistic steps include:

  • Electron Transfer: NADH binds to Complex I, transferring electrons to FMN, then through iron-sulfur clusters to ubiquinone .

  • Proton Translocation: Conformational changes during electron transport enable the movement of 4 H⁺ ions per cycle .
    Mutations in MT-ND6 disrupt this process, leading to diseases like Leber’s hereditary optic neuropathy (LHON) and Leigh syndrome .

Recombinant Production and Applications

Produced in E. coli systems, recombinant MT-ND6 is lyophilized for stability and shipped in Tris/PBS buffers . Its applications include:

  • Disease Research: Studying LHON-associated mutations (e.g., T14484C, G14459A) that impair Complex I-ubiquinone interactions .

  • Structural Studies: Mapping transmembrane domains and redox centers to understand electron transport pathologies .

  • Drug Development: Screening compounds targeting mitochondrial disorders linked to Complex I dysfunction .

Research Limitations and Future Directions

Current challenges include optimizing recombinant MT-ND6 stability in in vitro assays and resolving its interaction with auxiliary Complex I subunits like NDUFS3 . Advances in cryo-EM and mutagenesis screens are expected to clarify its role in reactive oxygen species (ROS) generation and disease mechanisms .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-174
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MTYVLFLLSVSLVMGFVGFSSKPSPIYGGLVLIVSGVVGCTIILNYGGGYMGLMVFLIYL GGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNS VGSWMIYEGEGPGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It is essential for the catalytic activity and assembly of complex I.
Database Links

KEGG: pps:807873

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of MT-ND6 in cellular metabolism?

MT-ND6 (NADH-ubiquinone oxidoreductase chain 6) functions as a critical component of mitochondrial Complex I in the electron transport chain. Within mitochondria, it participates in the first step of electron transfer during oxidative phosphorylation, specifically facilitating the transfer of electrons from NADH to ubiquinone . This process creates an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. The protein is embedded in the inner mitochondrial membrane and contributes to maintaining the proton-motive force necessary for ATP production . Disruptions in MT-ND6 function can significantly impair cellular energy metabolism and have been associated with several pathological conditions, including Leber hereditary optic neuropathy .

How does Pan paniscus MT-ND6 differ structurally and functionally from human MT-ND6?

Pan paniscus (bonobo) MT-ND6 shares significant sequence homology with human MT-ND6, but contains species-specific amino acid variations that may influence protein folding, stability, and interaction with other Complex I subunits. The bonobo MT-ND6 is studied as a recombinant protein produced using baculovirus expression systems, with a purity of >85% as determined by SDS-PAGE analysis . Unlike human MT-ND6, which has been extensively characterized in pathological contexts, Pan paniscus MT-ND6 offers researchers a comparative model to understand evolutionarily conserved functions of this mitochondrial protein. Sequence alignment studies between human and bonobo MT-ND6 reveal conservation in critical functional domains while highlighting species-specific variations that may contribute to differences in mitochondrial efficiency and metabolic adaptation.

What are the challenges in expressing and purifying functional MT-ND6 protein?

Expressing and purifying functional MT-ND6 presents several technical challenges due to its hydrophobic nature and mitochondrial membrane localization. Researchers must optimize expression systems carefully, with baculovirus systems proving effective for Pan paniscus MT-ND6 expression , while E. coli systems have been successfully used for rabbit MT-ND6 . Purification requires specialized approaches for membrane proteins, including appropriate detergent selection for solubilization without compromising protein structure. Tag systems (typically His-tag) facilitate purification but may impact protein folding or function if improperly positioned . Storage stability represents another challenge, with recommendations for lyophilization or storage with 5-50% glycerol at -20°C/-80°C to maintain protein integrity . Repeated freeze-thaw cycles significantly reduce protein activity, necessitating careful aliquoting strategies for long-term experimental planning.

What expression systems yield the highest functional activity for recombinant MT-ND6?

Comparative analysis of expression systems reveals differential efficacy for MT-ND6 production. Baculovirus expression systems yield functional Pan paniscus MT-ND6 with >85% purity , offering advantages for post-translational modifications and proper protein folding. E. coli expression systems have been successfully employed for rabbit MT-ND6 production with N-terminal His-tagging, achieving >90% purity by SDS-PAGE . The choice of expression system significantly impacts protein yield, folding, and functional activity. For structural studies requiring high purity and native conformation, insect cell-based expression systems generally outperform prokaryotic systems despite higher cost and complexity. Researchers should consider conducting pilot expressions in multiple systems, evaluating not only yield and purity but also functional activity through enzyme assays that measure electron transfer capability.

How can researchers effectively validate the functional activity of recombinant MT-ND6?

Validating recombinant MT-ND6 functional activity requires multiple complementary approaches. Enzymatic activity assays measure electron transfer rates using artificial electron acceptors like ferricyanide or ubiquinone analogs. Polarographic oxygen consumption measurements assess MT-ND6 contribution to respiratory chain function when reconstituted with other Complex I components. Blue Native PAGE combined with in-gel activity staining provides visual confirmation of MT-ND6 integration into functional Complex I assemblies. Membrane potential measurements using fluorescent probes like JC-1 or TMRM in reconstituted proteoliposomes verify the protein's contribution to proton translocation. Researchers should implement controls including known inhibitors (rotenone, piericidin A) to confirm specificity of observed activities. Comprehensive validation requires demonstrating both NADH oxidation capability and coupling to proton translocation, as these functions can become decoupled in improperly folded recombinant proteins.

What are the optimal buffer conditions for maintaining MT-ND6 stability during purification and storage?

MT-ND6 stability is highly dependent on buffer composition during both purification and storage phases. For purification, phosphate-based buffers (pH 7.4-8.0) containing mild non-ionic detergents (0.1-0.5% DDM or LMNG) effectively solubilize the protein while maintaining native structure . During storage, Tris/PBS-based buffer systems containing 6% trehalose at pH 8.0 have proven effective for rabbit MT-ND6 . For long-term storage, addition of 5-50% glycerol and aliquoting prevents protein degradation, with 50% glycerol concentration showing optimal results for both rabbit and Pan paniscus MT-ND6 preparations . Proper storage temperature is critical, with -20°C/-80°C recommended for both liquid and lyophilized forms. The shelf life varies by preparation method, with lyophilized forms maintaining stability for up to 12 months compared to 6 months for liquid preparations at -20°C/-80°C . Researchers should avoid repeated freeze-thaw cycles, as these significantly impair protein activity through denaturation and aggregation.

How can MT-ND6 be utilized in the development of inflammation-targeting therapeutics?

MT-ND6 has emerged as a promising target for treating severe inflammatory conditions based on research showing elevated N-formyl peptide MT-ND6 levels correlate with disease severity and mortality in critically ill patients with conditions like sepsis and severe acute pancreatitis . Therapeutic strategies focus on selectively removing MT-ND6 from circulation through designed peptide ligands with high binding affinity. Computer-aided molecular design has successfully identified peptides like RF that demonstrate strong MT-ND6 binding capacity . When immobilized on polystyrene-divinylbenzene microspheres (PS-RF), these peptides achieved 85.42±1.74% adsorption efficiency for MT-ND6, significantly outperforming unmodified microspheres (44.42±2.73%) . The adsorption capacity reached 6042.96 pg/g, demonstrating potential for hemoperfusion applications. Importantly, these adsorbents demonstrated excellent biocompatibility with no hemolytic effects, minimal impact on blood cell composition or coagulation activity, and no cytotoxicity . This approach represents a novel immunomodulatory strategy that could potentially reduce inflammatory damage in critical illness by targeting specific mitochondrial components rather than broadly suppressing immune function.

What techniques are most effective for studying MT-ND6 interactions with other Complex I subunits?

Investigating MT-ND6 interactions with other Complex I components requires sophisticated biophysical and biochemical approaches. Cross-linking mass spectrometry (XL-MS) using cell-permeable, reversible cross-linkers identifies direct protein-protein interactions within the Complex I assembly. Förster resonance energy transfer (FRET) with strategically labeled MT-ND6 and partner proteins provides quantitative interaction data in reconstituted systems or living cells. Cryo-electron microscopy has revolutionized structural analysis of membrane protein complexes, revealing MT-ND6 positioning within the assembled Complex I at near-atomic resolution. Surface plasmon resonance and microscale thermophoresis offer label-free quantification of binding affinities between MT-ND6 and partner proteins. For functional interaction studies, reconstitution of purified MT-ND6 with other Complex I components in proteoliposomes followed by activity measurements reveals how specific interactions contribute to electron transport and proton pumping activities. These complementary techniques provide both structural and functional insights into how MT-ND6 participates in Complex I assembly and operation.

How do mutations in MT-ND6 affect Complex I assembly and function in mitochondrial disorders?

Mutations in MT-ND6 significantly impact Complex I assembly and function, particularly in mitochondrial disorders like Leber hereditary optic neuropathy . These mutations typically alter single amino acids in the NADH dehydrogenase 6 protein, affecting protein folding, stability, or interactions with other Complex I components. Biochemical analysis of patient-derived samples reveals reduced Complex I activity, decreased NADH:ubiquinone oxidoreductase activity, and altered sensitivity to Complex I inhibitors. Blue Native PAGE analysis of mitochondrial extracts from affected tissues shows decreased fully assembled Complex I and accumulation of assembly intermediates, indicating compromised biogenesis pathways. Spectroscopic measurements demonstrate reduced electron transfer rates and altered redox potential of electron carriers within the complex. Functionally, these mutations often result in decreased proton pumping efficiency, leading to lower mitochondrial membrane potential and compromised ATP synthesis. The tissue-specific manifestation of symptoms, particularly in high-energy-demanding tissues like the optic nerve, reflects differential dependence on oxidative phosphorylation and vulnerability to bioenergetic deficits across tissues.

What bioinformatic approaches can predict the impact of MT-ND6 sequence variations on protein function?

Predicting functional consequences of MT-ND6 sequence variations requires integrated bioinformatic frameworks combining evolutionary, structural, and functional analyses. Multiple sequence alignment across species identifies evolutionarily conserved residues, with conservation suggesting functional importance; Pan paniscus and human MT-ND6 alignments reveal key conserved domains despite species divergence . Homology modeling based on available Complex I structures predicts three-dimensional conformations of variant proteins, with structural deviations from wild-type suggesting functional impairment. Molecular dynamics simulations quantify protein stability changes, hydrogen bonding networks, and conformational flexibility alterations induced by specific variants. Machine learning algorithms trained on known pathogenic mutations can classify novel variants based on multiple parameters including evolutionary conservation, physicochemical property changes, and structural context. Energy calculation methods like FoldX estimate changes in protein folding free energy (ΔΔG) associated with variants, with destabilizing mutations (ΔΔG > 1 kcal/mol) frequently correlating with dysfunction. Integration of these computational approaches with experimental validation provides powerful predictive capabilities for assessing MT-ND6 variants encountered in evolutionary studies or clinical genetics.

How can researchers effectively compare data from different recombinant MT-ND6 preparations to ensure experimental reproducibility?

Ensuring reproducibility across different MT-ND6 preparations requires systematic standardization and comparative analysis methods. The following table summarizes key standardization parameters and recommended approaches:

ParameterStandardization ApproachValidation Method
Protein PuritySDS-PAGE quantification with standardized loadingDensitometry analysis with >85-90% purity threshold
Functional ActivityNADH:ubiquinone oxidoreductase assay with defined substratesSpecific activity normalization (μmol/min/mg protein)
Structural IntegrityCircular dichroism spectroscopy monitoring secondary structureComparison to reference spectra for properly folded protein
Post-translational ModificationsMass spectrometry profilingIdentification and quantification of modification sites
Aggregation StateSize exclusion chromatography or dynamic light scatteringMonodispersity analysis and oligomeric state determination
Lipid/Detergent CompositionThin-layer chromatography or mass spectrometryQuantification of associated lipids/detergents

Researchers should implement internal controls including reference protein preparations with established characteristics. Statistical methods including ANOVA with post-hoc tests identify significant differences between preparations, while principal component analysis identifies patterns in multiparameter datasets. Documentation standards should include detailed reporting of expression systems, purification protocols, buffer compositions, and storage conditions to facilitate inter-laboratory reproducibility .

What are the current methodological limitations in studying MT-ND6 and how might they be overcome?

Current MT-ND6 research faces several methodological limitations requiring innovative solutions. The high hydrophobicity of MT-ND6 complicates expression and purification, necessitating specialized detergent systems that may alter native protein conformation. Novel approaches using amphipathic polymers (amphipols) or nanodiscs provide more native-like membrane environments while maintaining protein solubility. Functional reconstitution of MT-ND6 into Complete Complex I assemblies remains challenging due to the complexity of the 45-subunit complex. Development of minimal functional models incorporating only essential subunits offers a simplified system for studying MT-ND6 activity. The mitochondrial genetic origin of MT-ND6 limits conventional gene manipulation approaches. Advanced mitochondrial genome editing technologies using mitochondrially-targeted nucleases (mitoTALENs, mitoCRISPR) enable precise genetic manipulation of MT-ND6 in cellular and animal models. Low natural abundance and difficulty distinguishing MT-ND6 from other hydrophobic proteins complicates proteomic analysis. Implementation of targeted proteomics approaches using selected reaction monitoring mass spectrometry with isotopically labeled standards improves detection sensitivity and specificity. These methodological advances collectively expand research capabilities for understanding MT-ND6 biology in normal physiology and disease states.

What are the comparative advantages of using recombinant Pan paniscus MT-ND6 versus human MT-ND6 in drug screening applications?

Recombinant Pan paniscus MT-ND6 offers several distinct advantages over human MT-ND6 in drug screening applications. The high sequence homology (approximately 98%) between bonobo and human MT-ND6 preserves critical functional domains while providing sufficient variation to evaluate drug binding specificity . Bonobo MT-ND6 demonstrates excellent expression in baculovirus systems with >85% purity, offering superior yield and consistency compared to human MT-ND6, which often shows lower expression efficiency . The non-human origin eliminates potential contamination concerns with human pathogens, simplifying biosafety requirements for high-throughput screening operations. From a regulatory perspective, using non-human proteins in preliminary screening reduces complications associated with human-derived materials. Structurally, subtle differences in binding pocket conformations between species provide valuable information about drug selectivity and potential off-target interactions during lead optimization phases. Researchers can establish comparative binding models using both Pan paniscus and human MT-ND6 to identify compounds with optimal cross-species activity profiles, potentially predicting both efficacy and safety characteristics before advancing to clinical studies.

How can researchers design effective MT-ND6-targeting peptides for therapeutic applications?

Designing effective MT-ND6-targeting peptides requires an integrated approach combining computational modeling, in vitro validation, and optimization strategies. Initial peptide design should utilize molecular docking and molecular dynamics simulations to identify high-affinity binding configurations with MT-ND6 . Structure-activity relationship studies help identify critical binding motifs and optimize peptide length, with shorter peptides generally offering better manufacturing scalability and reduced immunogenicity. The table below summarizes key design parameters for MT-ND6-targeting peptides:

Design ParameterOptimization StrategyPerformance Indicator
Binding AffinityMolecular docking, MM-PBSA calculationsBinding energy (kcal/mol)
StabilityMD simulation analysis of complex stabilityRMSD over simulation time
SelectivityComparative binding studies with related proteinsAffinity ratio (target/non-target)
Adsorption CapacityImmobilization on carrier materialsMaximum capacity (pg/g) >6000
BiocompatibilityBlood cell interaction studiesNo hemolysis, maintained coagulation

The peptide RF, identified through computational screening, demonstrates exceptional performance with 85.42±1.74% MT-ND6 adsorption capacity when immobilized on polystyrene microspheres . For therapeutic implementation, optimization should focus on addressing peptide stability in biological fluids, developing appropriate delivery vehicles, and establishing dosing parameters based on pharmacokinetic modeling. Integration of these approaches accelerates development of peptide-based therapeutics targeting MT-ND6 for inflammatory conditions.

What mass spectrometry approaches are most effective for characterizing post-translational modifications in recombinant MT-ND6?

Characterizing post-translational modifications (PTMs) in recombinant MT-ND6 requires specialized mass spectrometry approaches optimized for membrane proteins. Bottom-up proteomics using multiple proteases (trypsin, chymotrypsin, and elastase) increases sequence coverage of hydrophobic regions where modifications may occur. Electron transfer dissociation (ETD) and electron capture dissociation (ECD) fragmentation methods preserve labile PTMs like phosphorylation and glycosylation during analysis, providing superior identification compared to collision-induced dissociation. Targeted multiple reaction monitoring (MRM) increases sensitivity for low-abundance modified peptides by focusing instrument time on predicted modification sites. Native mass spectrometry of intact MT-ND6 reveals the distribution of proteoforms with different modification patterns, providing a holistic view of protein heterogeneity. For comprehensive characterization, enrichment strategies using titanium dioxide (phosphorylation), hydrazide chemistry (glycosylation), or antibody-based methods (acetylation, methylation) increase detection sensitivity for specific modification types. Comparing PTM profiles between recombinant Pan paniscus MT-ND6 and native mitochondrial-derived protein identifies potential artifacts introduced during recombinant expression and guides optimization of expression systems to produce more physiologically relevant protein.

How can researchers accurately quantify the integration of recombinant MT-ND6 into functional Complex I assemblies?

Quantifying recombinant MT-ND6 integration into functional Complex I requires multifaceted analytical approaches. Blue Native PAGE (BN-PAGE) coupled with western blotting using antibodies against MT-ND6 and other Complex I subunits visualizes assembled complexes, with densitometry providing semi-quantitative integration assessment. More precise quantification employs stable isotope labeling with amino acids in cell culture (SILAC) followed by mass spectrometry to determine stoichiometric ratios of MT-ND6 to other Complex I components. Fluorescence correlation spectroscopy with fluorescently tagged MT-ND6 measures diffusion coefficients, distinguishing between free protein and complex-incorporated states based on molecular weight differences. Sucrose gradient ultracentrifugation separates free MT-ND6 from assembled complexes, with subsequent western blotting or mass spectrometry quantifying distribution. For functional assessment, activity-based quantification compares NADH:ubiquinone oxidoreductase activity before and after MT-ND6 incorporation, with activity increases proportional to successful integration. Researchers should implement both structural and functional quantification methods to comprehensively assess integration efficiency, as structural incorporation does not always guarantee functional contribution to enzymatic activity.

What computational methods can predict interactions between MT-ND6 and potential drug candidates?

Computational prediction of MT-ND6-drug interactions employs multiple in silico approaches with complementary strengths. Molecular docking algorithms identify potential binding sites and predict binding modes of small molecules to MT-ND6, with scoring functions estimating binding affinity. Consensus scoring using multiple algorithms improves prediction accuracy by balancing different energetic contributions. Molecular dynamics simulations extend beyond static docking to assess complex stability over nanosecond to microsecond timescales, revealing binding site fluctuations and conformational adaptations upon ligand binding. MM-PBSA/MM-GBSA calculations provide more accurate binding free energy estimates by accounting for solvent effects, entropy, and protein flexibility . Pharmacophore modeling identifies essential chemical features required for MT-ND6 binding based on known ligands, facilitating virtual screening of compound libraries. Fragment-based approaches decompose potential drugs into constituent parts to identify optimal chemical scaffolds for binding specific MT-ND6 pockets. Machine learning models trained on experimental binding data can predict interaction profiles for novel compounds based on chemical fingerprints and physicochemical properties. These computational methods significantly accelerate drug discovery by prioritizing promising compounds for experimental validation, as demonstrated in the successful development of MT-ND6-binding peptides for inflammatory disease applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.