Recombinant Pan paniscus Probable G-protein coupled receptor 33 (GPR33)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in E. coli systems, leveraging bacterial efficiency for high-yield production:

ParameterSpecification
Expression HostEscherichia coli (E. coli)
Purification MethodImmobilized metal affinity chromatography (IMAC) via His-tag
Purity>90% (SDS-PAGE)
FormulationLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Reconstitution recommendations include using sterile deionized water and adding glycerol (5–50%) for long-term storage at -80°C .

Signaling Pathways

Studies using chimeric receptors (e.g., Opto-GPR33) demonstrate that ancestral GPR33 activates canonical GPCR pathways:

  • cAMP Modulation: Light-induced activation reduces cAMP levels, indicative of Gαi/o coupling .

  • MAPK/ERK and Rho Pathways: SRE/SRE.L reporter assays confirm downstream signaling .

  • Internalization: Activated GPR33 undergoes receptor internalization, a trait linked to pathogen entry mechanisms .

Evolutionary and Immunological Relevance

  • GPR33 is a pseudogene in humans but retains intact alleles in ~10% of the population .

  • In bonobos, it is hypothesized to play roles in innate immunity, including dendritic cell function and pathogen defense .

  • Optical resurrection experiments (e.g., light-activated chimeric receptors) highlight its ancestral role in immune surveillance .

Applications in Research

ApplicationDescription
GPCR Signaling StudiesUsed to map intracellular pathways (e.g., cAMP, MAPK)
Pathogen Interaction ModelsInvestigated as a potential pathogen entry site due to internalization
Drug DiscoveryTarget for orphan GPCR therapeutic development

Comparative Analysis with Orthologs

SpeciesKey Differences
Human (Pseudogene)Inactivated allele predominant; residual intact alleles rare
Mouse (Gpr33)Functional ortholog linked to toll-like receptor (TLR) signaling
Rat (Gpr33)Retains chemokine-like receptor functions

Key Research Findings

  • Optical Functionalization: Engineered light-activated GPR33 chimeras revealed conserved signaling mechanisms across Class A GPCRs .

  • Population Genetics: Human GPR33 pseudogenization correlates with historical pathogen pressures .

  • Structural Modularity: Intracellular loops (ICL1-3) are critical for downstream signaling, validated via domain-swapping experiments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
GPR33; Probable G-protein coupled receptor 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQ TVNTLLFFHLILSYFISTMILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLS AIGLDRYLLTLHPVWSQQHRTPRWASSIVLGVWISAAALSIPYLIFRQTHHDRKGKVTCQ NNYAVSTNWESKEMQALRQWIHVACFISRFLLGFLLPFFIIIFCYERVASKVKERSLFKS SKPFKVMMTAIISFFVCWMPYHIHQGLLLTMNQSLLLELTLILTVLTTSFNTIFSPTLYL FVGENFKKVFKKSILALFESTFSEDSSVERTQT
Uniprot No.

Target Background

Function

Orphan receptor; potentially functions as a chemoattractant receptor.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of GPR33 and how does it differ between humans and Pan paniscus?

GPR33 belongs to the G-protein coupled receptor family characterized by seven transmembrane domains. The human GPR33 contains a premature stop codon after the third transmembrane domain, rendering it a pseudogene, while maintaining detectable mRNA expression in various tissues . For recombinant expression studies, the full receptor typically consists of 333 amino acids as seen in functional variants . While specific differences between human and Pan paniscus GPR33 aren't explicitly detailed in current literature, comparative genomic approaches would likely reveal conservation patterns in the functional regions of these closely related species. Researchers should perform sequence alignment studies focusing on the transmembrane domains and ligand-binding regions to identify key structural differences.

How can researchers determine the expression profile of GPR33 in different tissues?

Expression analysis of GPR33 can be conducted using multiple complementary approaches for comprehensive profiling. RNA-seq and TaqMan arrays have demonstrated superior sensitivity and dynamic range compared to Affymetrix arrays when quantifying GPCR expression . For GPR33 specifically, detection requires careful primer design due to its pseudogene status in some species. Time-course experiments have shown that GPR33 expression peaks approximately 8 hours after stimulation with TLR activators like poly I:C . When designing expression studies, researchers should:

  • Employ multiple detection methods (RNA-seq and qPCR) for cross-validation

  • Include appropriate tissue controls known to express GPR33 (lymphoid organs)

  • Consider stimulation with TLR activators to enhance detection

  • Include both baseline and stimulated conditions

  • Design primers that can distinguish between intact and pseudogene variants

What is the evolutionary significance of GPR33 pseudogenization in humans compared to functional variants in other species?

The pseudogenization of GPR33 in humans, other hominoids, and some rodent species occurred independently within the last 1 million years, suggesting selective pressure rather than neutral drift . Population genetic analysis reveals that the inactive GPR33 null-allele is near fixation in European populations (approaching 100%), while showing lower frequencies in African and Asian populations . This pattern suggests potential past selection related to pathogen resistance.

The maintenance of functional GPR33 in Pan paniscus and other species provides a valuable comparative model for understanding the biological role of this receptor. Research methodologies should include:

  • Phylogenetic analysis across primate species

  • Population genetics studies to detect signatures of selection

  • Functional comparison between pseudogenized and intact variants

  • Assessment of geographical distribution of allele frequencies in relation to historical pathogen exposure

What expression systems are most effective for producing recombinant Pan paniscus GPR33 protein?

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, scalableLimited post-translational modificationsStructural studies, antibody production
Mammalian cells (HEK293, CHO)Native-like post-translational modificationsLower yield, higher costFunctional studies, signaling assays
Insect cellsHigher yield than mammalian, some PTMsModerate costCrystallography, ligand binding studies
Cell-free systemsRapid production, easily modifiedLimited folding capabilityInitial screening, mutational analysis

When expressing GPR33 in E. coli, optimal results have been achieved using BL21(DE3) strains with induction at lower temperatures (16-18°C) to improve proper folding of membrane proteins .

What purification strategies yield highest purity and functionality for recombinant GPR33?

Purification of recombinant GPR33 requires careful handling to maintain protein integrity. Current literature indicates successful purification using His-tag affinity chromatography . A comprehensive purification protocol should include:

  • Cell lysis optimization (detergent selection critical for membrane proteins)

  • Affinity chromatography using Ni-NTA or similar matrices

  • Size exclusion chromatography to remove aggregates

  • Protein quality assessment via SDS-PAGE and Western blotting

  • Functional verification through binding or signaling assays

For storage, lyophilized powder forms with 6% trehalose in Tris/PBS-based buffer (pH 8.0) have shown good stability . Repeated freeze-thaw cycles should be avoided, with recommended working aliquot storage at 4°C for up to one week . For long-term storage, addition of 50% glycerol and storage at -20°C/-80°C is recommended .

How can researchers verify the structural integrity of purified recombinant GPR33?

Verification of structural integrity for GPR33 should employ multiple analytical techniques:

  • SDS-PAGE for purity assessment (>90% purity is generally considered acceptable)

  • Circular dichroism (CD) spectroscopy to verify secondary structure elements characteristic of GPCRs

  • Limited proteolysis to assess proper folding

  • Thermal stability assays to determine protein stability

  • If possible, ligand binding assays using known or putative ligands

For functional verification in the absence of known natural ligands, engineered chimeric receptors containing the signaling domains of GPR33 linked to light-sensing domains (as in Opto-GPR33) can be used to assess signaling capacity .

What signaling pathways are activated downstream of GPR33 and how can researchers measure them?

Based on current research, GPR33 appears to couple to multiple signaling pathways. Studies using chimeric Opto-GPR33 constructs have demonstrated activation of:

  • cAMP-dependent pathways

  • Ca²⁺-dependent signaling

  • MAPK/ERK pathways

  • Rho-dependent pathways

Specifically, light stimulation of engineered Opto-GPR33 reduced CRE reporter activity and induced SRE/SRE.L reporters, suggesting G-protein-mediated signaling . To measure these pathways, researchers should employ:

  • Reporter gene assays (CRE, SRE, NFAT)

  • Second messenger quantification (cAMP, Ca²⁺)

  • Phosphorylation status of downstream effectors (ERK1/2, CREB)

  • GTPase activity assays for Rho-dependent signaling

  • Electrophysiological techniques for ion channel modulation

For calcium mobilization studies, fluorescent indicators combined with real-time microscopy allows detection of transient signals with appropriate kinetics (60-90 seconds for typical GPCR responses) .

How does GPR33 expression change in response to immune stimulation?

GPR33 expression is dynamically regulated by immune stimulation through toll-like receptor (TLR) pathways and AP-1/NF-κB signaling cascades . Both in vitro and in vivo studies have demonstrated upregulation of GPR33 in response to TLR activators:

  • LPS (TLR4 activator)

  • Poly I:C (TLR3 activator, mimics viral infection)

  • R-848 (TLR7 activator, recognizes single-stranded viral RNA)

  • Zymosan A (TLR2/6 activator)

  • PMA and chloroquine (AP-1 and NF-κB pathway activators)

Expression peaks approximately 8 hours after stimulation . Notably, cycloheximide (protein synthesis inhibitor) blocks poly I:C-induced GPR33 expression, suggesting that intermediate proteins are required for GPR33 transcriptional regulation . For studying GPR33 expression dynamics, researchers should:

  • Design time-course experiments (0-24h)

  • Include multiple TLR activators for pathway comparison

  • Use pathway inhibitors to confirm signaling mechanisms

  • Examine both mRNA and protein levels

  • Consider tissue-specific expression patterns (highest in spleen and lungs after stimulation)

What experimental approaches can overcome the limitations of studying an orphan receptor like GPR33?

Studying orphan receptors presents significant challenges due to unknown endogenous ligands. Several innovative approaches can circumvent these limitations:

  • Optogenetic engineering: Creating chimeric receptors like Opto-GPR33 that contain the signaling domains of GPR33 linked to light-sensing domains of rhodopsin allows precise activation with visible light . This approach has successfully revealed signaling properties of human GPR33 despite its pseudogene status .

  • Reverse pharmacology: Systematic screening of compound libraries against cells expressing GPR33 to identify potential ligands.

  • Bioinformatic prediction: Using sequence homology with known GPCRs to predict potential ligand classes.

  • Transcriptional profiling: Comparing gene expression changes induced by GPR33 with those of characterized GPCRs to infer functional similarities.

  • Constitutively active mutants: Engineering mutations that render the receptor constitutively active to study downstream signaling.

The optogenetic approach has proven particularly valuable, as demonstrated by the identification of signaling pathways downstream of the engineered Opto-GPR33 receptor .

What methodological considerations are important when comparing GPR33 across different primate species?

Cross-species comparative analysis of GPR33 requires careful methodological planning:

  • Sequence alignment optimization: Ensure alignment methods account for insertions/deletions particularly around the pseudogenization site in humans (premature stop codon after the third transmembrane domain) .

  • Expression detection methods: RNA-seq and TaqMan qPCR provide superior detection sensitivity compared to microarray approaches, with RNA-seq showing a wider dynamic range for detecting GPCRs . This is particularly important when comparing pseudogenized variants (potentially with lower expression) to functional variants.

  • Standardized functional assays: When comparing signaling properties, use identical reporter systems and assay conditions across species variants to ensure valid comparisons.

  • Controlled expression levels: Normalize expression levels when performing functional comparisons to account for potential differences in protein production efficiency.

  • Phylogenetic context: Interpret findings within a comprehensive phylogenetic framework including multiple primate species to distinguish species-specific adaptations from broader evolutionary patterns.

How can optogenetic approaches be applied to study GPR33 signaling dynamics?

Optogenetic engineering of GPR33 has emerged as a powerful approach to study its signaling properties despite its orphan receptor status. Researchers have successfully created chimeric receptors containing the signaling domains of human GPR33 functionally linked to the light-sensing domain of rhodopsin (Opto-GPR33) . This approach offers several methodological advantages:

  • Precise temporal control: Light stimulation allows millisecond-scale activation, enabling the study of signaling kinetics.

  • Spatial specificity: Targeted illumination can activate receptors in specific cellular compartments or tissues.

  • Bypassing ligand limitations: Activation does not require identification of endogenous ligands.

  • Quantitative stimulation: Light intensity can be precisely controlled to study dose-dependent responses.

  • Resurrection of pseudogene function: Even the human pseudogene variant can be studied by incorporating the truncated signaling domains into the chimeric construct .

Implementation requires careful design of chimeric constructs, typically fusing the intracellular loops and C-terminal tail of GPR33 with the transmembrane helices of rhodopsin. Expression in appropriate cell systems with reporters for various signaling pathways (cAMP, Ca²⁺, MAPK/ERK, Rho) allows comprehensive characterization of downstream signaling .

What approaches can identify potential ligands for Pan paniscus GPR33?

Identifying natural ligands for orphan receptors like GPR33 requires systematic approaches:

  • Phylogenetic analysis: Compare GPR33 with closely related receptors of known ligand specificity to predict potential ligand classes.

  • Tissue extract fractionation: Prepare extracts from tissues with high GPR33 expression (lymphoid organs), fractionate by chromatography, and test fractions for receptor activation using functional assays.

  • Candidate-based approach: Test compounds known to activate related receptors or compounds related to the receptor's physiological context (immune mediators for GPR33).

  • High-throughput screening: Screen diverse compound libraries using cells expressing GPR33 coupled to reporter systems for common GPCR signaling pathways.

  • In silico docking: Perform molecular docking studies using homology models of GPR33 to predict potential ligands.

  • Metabolomics approach: Compare metabolites from wild-type and GPR33-knockout models to identify potential endogenous ligands.

When establishing screening assays, calcium mobilization and ERK phosphorylation have proven effective for detecting signaling downstream of orphan GPCRs .

How can CRISPR-Cas9 technology be applied to study GPR33 function in Pan paniscus models?

CRISPR-Cas9 technology offers powerful approaches for studying GPR33 function:

  • Knockout studies: Generate GPR33-deficient cell lines or animal models to identify phenotypic consequences, particularly focusing on immune function given GPR33's regulation by TLR pathways .

  • Knock-in modifications: Introduce reporter tags (e.g., fluorescent proteins) to monitor endogenous GPR33 expression and localization.

  • Humanization studies: Replace Pan paniscus GPR33 with human pseudogene variant to study functional consequences of pseudogenization.

  • Domain modifications: Perform precise editing of specific domains to identify key residues for signaling and regulation.

  • Conditional regulation: Implement conditional expression systems to control GPR33 expression in specific tissues or developmental stages.

  • Paralog replacement: Replace GPR33 with related receptors to assess functional redundancy within the GPCR family.

For CRISPR-based approaches, careful guide RNA design is essential, particularly for GPCRs which contain highly conserved regions and may have paralogs in the genome. Off-target analysis and validation of editing efficiency should be rigorously performed.

How can researchers address contradictory results in GPR33 expression studies?

Contradictory results in GPR33 expression studies may arise from methodological differences. To address these contradictions, consider:

  • Detection method limitations: RNA-seq and qPCR provide superior sensitivity for detecting GPCRs compared to microarray approaches. Studies have shown poor correlation (R² < 0.4) between Affymetrix array results and TaqMan arrays or RNA-seq for GPCR expression . When comparing studies, prioritize data from more sensitive methods.

  • Stimulation conditions: GPR33 expression is highly dependent on immune stimulation timing. Peak expression occurs approximately 8 hours after TLR stimulation , so differences in sampling timepoints may yield contradictory results.

  • Cell-type specificity: GPR33 expression varies significantly across cell types, with highest expression in dendritic cells and specific lymphoid tissues after immune stimulation . Ensure cell type or tissue comparisons are appropriate.

  • Splice variant detection: RNA-seq analysis can reveal splice variants that may be missed by primer-specific methods . Consider analyzing raw sequencing data to identify potential variant-specific expression patterns.

  • Cross-reactivity: For protein-level detection, antibody cross-reactivity with related GPCRs may confound results. Validate antibody specificity using knockout controls.

What are common pitfalls in functional assays for GPR33 and how can they be addressed?

Functional characterization of GPR33 presents several challenges:

  • Orphan receptor status: Without known endogenous ligands, activation-dependent assays are difficult. Solution: Use chimeric optogenetic approaches (Opto-GPR33) that allow light-controlled activation .

  • Low expression levels: GPCRs often express at low levels, making detection challenging. Solution: Optimize codon usage for expression system and consider using high-sensitivity detection methods.

  • Background signaling: Endogenous receptors in host cells may confound results. Solution: Use receptor-null cell lines or include appropriate negative controls.

  • Receptor internalization: Rapid internalization may limit detection windows. Solution: Include time-course measurements and consider using internalization-resistant mutants.

  • Species-specific coupling: G-protein coupling preferences may vary between species variants. Solution: Test multiple signaling pathways (Gαs, Gαi/o, Gαq/11, Gα12/13) when characterizing receptor function.

  • Pseudogene complications: When studying human GPR33, the premature stop codon creates truncated protein. Solution: When expressing human GPR33, specify whether working with the pseudogene variant or an engineered full-length version.

How can researchers differentiate between direct and indirect effects when studying GPR33 signaling?

Distinguishing direct from indirect signaling events downstream of GPR33 requires systematic approaches:

  • Rapid time-course analysis: Direct signaling events occur within seconds to minutes (calcium transients typically within 60-90 seconds for GPCRs) , while secondary effects take longer. Implement high-temporal resolution measurements.

  • Pathway inhibitors: Use specific inhibitors of known GPR33 downstream pathways. For example, inhibitors of NF-κB signaling (celastrol, BAY) and AP-1 signaling (U-0126, NDGA) have been shown to block GPR33 transcriptional regulation .

  • Protein synthesis inhibition: Cycloheximide treatment blocks GPR33 expression induced by poly I:C, indicating requirement for intermediate protein synthesis . This approach can identify signaling events dependent on new protein production.

  • G-protein subtype validation: Use pertussis toxin (Gαi/o inhibitor), YM-254890 (Gαq/11 inhibitor), or G-protein selective knockout cells to confirm direct coupling.

  • Mutational analysis: Introduce mutations in key signaling motifs of GPR33 to disrupt specific pathways and confirm direct coupling.

  • Reconstitution in minimal systems: Express GPR33 with defined signaling components in reconstituted systems to demonstrate direct interactions.

  • Proximity labeling: Use techniques like BioID or APEX to identify proteins in close proximity to activated GPR33.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.