Recombinant Pan paniscus Probable G-protein coupled receptor 34 (GPR34)

Shipped with Ice Packs
In Stock

Description

Production Systems and Reagents

Recombinant Pan paniscus GPR34 is produced in multiple expression systems, as shown below:

Product CodeExpression SystemTag/Purification Method
CSB-CF666066EQUE. coli (in vitro)Native conformation
CSB-YP666066EQU1YeastN-terminal His-tag
CSB-EP666066EQU1Baculovirus/insect cellsC-terminal Fc fusion
CSB-MP666066EQU1Mammalian cells (HEK293)Avi-tag for biotinylation

Source: Cusabio , Creative BioMart

These systems enable large-scale production for applications ranging from structural biology to drug screening.

Ligand Binding and Signaling

  • LysoPS recognition: Recombinant GPR34 binds 2-acyl LysoPS with high specificity, activating downstream Gi/o-mediated pathways (e.g., cAMP reduction, PI3K-AKT, and RAS-ERK signaling) .

  • Superagonists: Modified ligands like M1 (an aromatic fatty acid surrogate) enhance receptor activation by stabilizing hydrophobic interactions in the TM4-5 pocket .

Immune Modulation

  • Microglial phagocytosis: GPR34 activation promotes Aβ fibril clearance in Alzheimer’s disease models, mediated by cAMP suppression .

  • Lymphoma association: Truncation mutants (e.g., Q340X) show delayed internalization and hyperactivation of CRE, NF-κB, and AP1 pathways, linked to mucosa-associated lymphoid tissue (MALT) lymphoma .

Neurodegenerative Diseases

  • Alzheimer’s disease: GPR34 agonists like M1 enhance microglial uptake of Aβ fibrils by 40–60% in vitro and in vivo .

  • Parkinson’s disease: Elevated GPR34 in the striatum correlates with neuroinflammatory responses .

Cancer Biology

  • Salivary gland MALT lymphoma: Mutant GPR34 promotes resistance to apoptosis and phospholipase-A1/2 activation, driving paracrine stimulation of malignant B cells .

Challenges and Future Directions

  • Ligand instability: Native LysoPS is chemically unstable, necessitating synthetic analogues like S3E-LysoPS for experimental use .

  • Species-specific variations: Most functional data derive from human or mouse homologs, requiring validation in Pan paniscus models.

Targeting GPR34 with selective agonists or antagonists holds therapeutic potential for immune disorders and neurodegenerative diseases, pending further mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format preferences, kindly include your request in the order notes, and we will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method or location. For precise delivery estimates, please contact your local distributor.
Note: All our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Should you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR34; Probable G-protein coupled receptor 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK PGYSLHDTSVAVKIQSSSKST
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural basis for lysophosphatidylserine (LysoPS) recognition by GPR34?

    GPR34 contains a uniquely structured binding pocket that accommodates LysoPS through specific molecular interactions. Recent cryo-electron microscopy studies of human GPR34-Gi complexes reveal that the binding pocket is laterally open toward the membrane, facilitating the entry of lipidic agonists. The serine moiety of LysoPS is recognized by a charged residue cluster, while the acyl chain fits into an L-shaped hydrophobic pocket formed between transmembrane domains 4 and 5 (TM4-5) .

    This pocket features bulky residues F219^5.39 and L223^5.43 in TM5, with smaller residues A182^4.53 and G185^4.56 positioned in TM4. The acyl chain of LysoPS bends at the cis-9 double bond to accommodate this L-shaped pocket, with the C1-C9 chain exposed to the membrane environment . This structural arrangement explains GPR34's preference for certain LysoPS analogs and provides a foundation for understanding species-specific differences.

  • How does GPR34 signaling function in different cell types?

    GPR34 primarily couples to Gi proteins, inhibiting adenylyl cyclase and modulating various downstream pathways depending on cell type . In microglia, GPR34 regulates homeostatic functions, with its loss accelerating transition to disease-associated microglia (DAM) states . This transition involves characteristic transcriptional changes and altered metabolic activity.

    In cardiomyocytes, GPR34 activation by 18:0 lysophosphatidylserine induces necrotic cell death through mechanisms distinct from apoptosis . Knockdown experiments demonstrate that GPR34, but not the related GPR132, mediates this lysophosphatidylserine-induced necrosis.

    In glioma cells, GPR34 promotes malignancy by enhancing epithelial-mesenchymal transition (EMT) and activating TGF-β/Smad signaling, affecting cell cycle progression and invasive capacity . These diverse functions highlight the context-dependent nature of GPR34 signaling.

  • What is the tissue distribution pattern of GPR34 expression?

    GPR34 shows a distinctive expression pattern across tissues, with particularly high levels in:

    • Brain (especially in microglial cells)

    • Glia cells

    • Mast cells

    • Spleen

    • Heart

    • Kidney

    • Liver

    This expression pattern is relatively conserved across mammals, suggesting fundamental roles in these tissues. In the central nervous system, GPR34 is predominantly expressed in microglia, where it plays important roles in maintaining homeostatic functions . The receptor's expression in immune cells further supports its immunomodulatory functions.

  • How evolutionarily conserved is GPR34 across species?

    GPR34 belongs to the P2Y12-like receptor group with a deep evolutionary history. Phylogenetic studies indicate that P2Y12-like receptors, including GPR34, emerged more than 450 million years ago, before the split between cartilaginous and bony fish .

    GPR34 and GPR34-like receptors have been identified in sharks (Mustelus manazo, Carcharodon carcharias) and chimeras (Callorhinchus milii), but attempts to identify these receptors in lampreys (Petromyzon marina) and sea urchins (Strongylocentrotus purpuratus) have been unsuccessful . This suggests GPR34 likely originated in early Gnathostomata (jawed vertebrates).

    The conservation of key structural elements across mammalian GPR34 homologs, including those from humans and likely Pan paniscus, indicates functional conservation of the basic ligand recognition and signaling properties.

Advanced Research Questions

  • What experimental approaches are most effective for studying GPR34 activation mechanisms?

    Multiple complementary approaches provide robust insights into GPR34 activation:

    Structural Analysis:

    • Cryo-electron microscopy has successfully resolved GPR34-Gi complexes bound to ligands such as S3E-LysoPS and modified agonists like M1 .

    • These structures reveal critical details about ligand binding and receptor conformational changes.

    Functional Assays:

    • Cell-based activation assays using recombinant PS-PLA1 protein, which generates LysoPS in situ, can activate GPR34 at the cellular level .

    • Control experiments with albumin, which extracts lysophospholipids from membranes, can distinguish between membrane-associated and free LysoPS activation mechanisms .

    • Mutagenesis of key residues (A182W, G185F, G185W) that close the TM4-5 gap helps validate lateral access mechanisms for ligands .

    Receptor-Ligand Interaction Studies:

    • Structure-activity relationship (SAR) studies with synthetic LysoPS analogs that mimic different regioconfigurations (sn-1, sn-2, sn-3) have identified selective GPR34 agonists .

    • Metabolically stable agonists like M1, where fatty acid is replaced with an aromatic group, provide valuable tools for prolonged receptor activation studies .

    These methodologies must be carefully optimized when working with recombinant Pan paniscus GPR34 to account for potential species-specific differences in ligand preference and signaling.

  • How does GPR34 regulate microglial function in neurodegenerative contexts?

    GPR34 plays a critical role in microglial homeostasis with significant implications for neurodegenerative diseases:

    Microglia State Regulation:

    • GPR34 knockout (KO) accelerates the conversion of homeostatic microglia to disease-associated microglia (DAM) states in both healthy and amyloid mouse models .

    • Single-cell RNA sequencing revealed that at 8 and 17 months, GPR34 KO microglia show reduced homeostatic microglia populations with corresponding increases in intermediate (DAM-1) and advanced (DAM-2) subpopulations .

    Metabolic Consequences:

    • GPR34 KO rescues dysregulated cholesterol metabolism in TREM2 KO iPSC-derived microglia (iMG) .

    • Loss of GPR34 promotes fatty acid catabolism without the proton leak observed in TREM2 KO .

    Signaling Pathways:

    • GPR34 knockout downregulates ERK signaling, while agonism promotes interaction with and activation of ERK .

    • In amyloid mouse models, GPR34 KO increases the frequency of large plaques compared to wild-type, suggesting that GPR34 KO microglia may promote amyloid aggregation .

    Experimental Approaches:

    • CRISPR-mediated knockout models in differentiated iPSC-derived microglia provide valuable tools to study GPR34 function .

    • Morphometric analysis of Iba1+ and CD68+ microglia in mouse brain sections can quantify microglial changes associated with GPR34 manipulation .

    These findings suggest GPR34 as a potential therapeutic target for modulating microglial function to slow Alzheimer's disease progression.

  • What role does GPR34 play in cardiac pathophysiology and how can it be studied?

    GPR34 has significant implications in cardiac dysfunction:

    Necrotic Cell Death Mechanism:

    • 18:0 lysophosphatidylserine induces necrotic cell death via GPR34 in rat neonatal cardiomyocytes in both time- and dose-dependent manners .

    • This is characterized by PI+TUNEL- cells, indicating a necrotic rather than apoptotic mechanism .

    Experimental Methods:

    • siRNA knockdown approaches effectively suppress GPR34 expression in cardiomyocytes, reducing lysophosphatidylserine-induced cell death .

    • Cell viability assays combined with PI/TUNEL staining provide clear discrimination between necrotic and apoptotic mechanisms .

    In Vivo Models:

    • Gpr34-/- mice show reduced LV chamber dilation and improved cardiac function compared to Gpr34+/+ controls after transverse aortic constriction (TAC) .

    • Histological analysis of cellular infiltration and HMGB1 release from nuclei (indicating necrotic cell death) demonstrate reduced cardiac injury in Gpr34-/- mice .

    Therapeutic Implications:

    • GPR34 ablation attenuates the development of cardiac dysfunction induced by pressure overload, suggesting it as a potential therapeutic target in heart failure .

    • The necrosis-specific pathway involving GPR34 represents a distinct therapeutic opportunity compared to apoptotic pathways.

  • How can one optimize expression and purification of recombinant GPR34 for structural studies?

    Producing functional recombinant GPR34 presents several challenges that require specific methodological approaches:

    Expression Systems:

    • Successful expression and functional study of GPR34 has been achieved using the Sf9 insect cell system, which has also proven effective for related receptors like P2Y12 and P2Y14 .

    • Mammalian expression systems may better preserve post-translational modifications and maintain proper folding.

    Construct Design:

    • Addition of fusion partners (e.g., T4 lysozyme) or thermostabilizing mutations may enhance stability and crystallization properties.

    • Truncation of flexible N- and C-terminal regions while preserving key signaling domains improves expression and stability.

    Purification Strategy:

    • A two-step affinity purification approach using polyhistidine tags followed by size exclusion chromatography yields high-purity GPR34.

    • Maintaining receptor stability requires careful selection of detergents, with n-dodecyl-β-D-maltopyranoside (DDM) often proving effective for GPCRs.

    Stability Assessment:

    • Thermal stability assays (TSA) can identify optimal buffer conditions and ligands that enhance receptor stability.

    • Monitoring receptor activity using ligand binding assays confirms that purified protein retains functional properties.

    Complex Formation:

    • For structural studies, co-expression with G proteins or formation of the GPR34-G protein complex post-purification improves stability and facilitates structural determination .

    • The successful resolution of human GPR34-Gi complexes bound to ligands provides a template for similar studies with Pan paniscus GPR34 .

  • How do GPR34 mutations contribute to lymphoid malignancies?

    GPR34 mutations have significant implications in lymphoid cancers, particularly mucosa-associated lymphoid tissue (MALT) lymphoma:

    Mutation Patterns:

    • The majority of GPR34 mutations in MALT lymphoma cluster in the cytoplasmic tail, potentially creating truncated gain-of-function proteins .

    • These truncations eliminate or impair key phosphorylation motifs that regulate receptor desensitization, leading to constitutive receptor signaling .

    • Missense mutations such as Y327N (between transmembrane domain and cytoplasmic tail) and R84H/D151A (at intracellular loops) also induce constitutive receptor activation .

    Chromosomal Translocations:

    • GPR34 deregulation through juxtaposition to IGVH gene sequences via t(X;14)(p11;q32) chromosomal translocation has been reported in MALT lymphoma cases .

    • Elevated GPR34 expression occurs in most MALT lymphoma cases, independent of translocation, suggesting multiple mechanisms of dysregulation .

    Signaling Consequences:

    • Constitutive activation leads to increased proliferation through sustained activation of ERK and NF-κB pathways .

    • In autoimmune disorder settings, increased amounts of lysophosphatidylserine in chronically inflamed tissues may further drive GPR34 activation .

    Experimental Approaches:

    • Functional characterization through mutation analysis and signaling pathway assessment provides insights into oncogenic mechanisms.

    • Cell line models with inducible expression of mutant GPR34 can elucidate the effects on cellular transformation and proliferation.

  • What are the key considerations for designing selective GPR34 agonists and antagonists?

    Rational design of GPR34-targeted compounds requires understanding several structural and functional factors:

    Structure-Activity Relationships:

    • Synthetic LysoPS analogs with the sn-3 configuration show high potency and selectivity for GPR34 .

    • Replacement of fatty acid with aromatic groups has successfully created potent and metabolically stable GPR34 agonists, like the compound M1 .

    Binding Pocket Characteristics:

    • The L-shaped hydrophobic pocket formed between TM4-5 accommodates the acyl chain of LysoPS, with the chain bent at the cis-9 double bond .

    • The charged residue cluster recognizes the serine moiety's amine and carboxylate groups .

    Ligand Entry Mechanisms:

    • The laterally open binding pocket allows both membrane and extracellular access for ligands .

    • In designing ligands, consideration of this dual access mechanism is important, as it affects bioavailability and target engagement.

    Specificity Considerations:

    • Other lysophospholipid-sensing GPCRs (GPR174, P2Y10, GPR132) show overlapping ligand preferences, requiring careful design to achieve selectivity .

    • Molecular dynamics simulations can predict ligand-regioselectivity for GPR34, guiding the design of specific compounds .

    Therapeutic Applications:

    • In cancer contexts (like glioma), antagonists targeting GPR34-mediated TGF-β/Smad signaling may offer therapeutic potential .

    • For neurodegenerative conditions, compounds modulating GPR34's role in microglial activation could provide new treatment avenues .

  • How can GPR34 function in glioma progression be investigated?

    GPR34's role in glioma progression can be systematically studied through multiple experimental approaches:

    Expression Analysis:

    • Bioinformatic analysis of RNA-seq and clinical data from GEO, TCGA, and GTEx databases reveals GPR34 expression patterns in glioma .

    • TIMER database and ssGSEA methods can assess associations between GPR34 expression and immune infiltration levels .

    Prognostic Value:

    • Cox regression analysis can determine whether GPR34 expression serves as an independent prognostic indicator for glioma .

    • Correlation of GPR34 expression with clinicopathological features helps establish its predictive value .

    Functional Studies:

    • Cell Counting Kit-8, colony formation, wound healing, and Transwell assays can assess how GPR34 manipulation affects glioma cell viability and migratory/invasive potential .

    • Knockdown and overexpression approaches determine the direct effects of GPR34 on cellular phenotypes .

    Pathway Analysis:

    • Gene set enrichment analysis (GSEA) identifies biological pathways associated with GPR34 expression levels .

    • Western blotting for EMT markers (N-cadherin, Snail, vimentin, E-cadherin) and TGF-β/Smad pathway components reveals underlying mechanisms .

    Therapeutic Targeting:

    • Inhibition of downstream pathways (e.g., using TGF-β inhibitor LY2157299) can reverse oncogenic effects associated with GPR34 overexpression .

    • Such experiments provide proof-of-concept for GPR34-targeted therapeutic strategies in glioma.

    These approaches collectively demonstrate that GPR34 enhances glioma malignancy by promoting EMT-like processes, G1/S phase cell cycle transition, and TGF-β/Smad signaling activation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.