Recombinant Pan paniscus Taste receptor type 2 member 10 (TAS2R10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
TAS2R10; Taste receptor type 2 member 10; T2R10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MLRVVEGIFIFVVISESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI IITDGFIQIFSPNIYASSNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW LKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKMKNDTVWDLNMYKSEYFIKQILLNL GVIFFFTLSLITCVLLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF IGMAIEISYFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK RKNLRVT
Uniprot No.

Target Background

Function

A receptor potentially involved in bitterness perception and linked to gustducin. It may contribute to sensing gastrointestinal chemical composition. Activation of this receptor may stimulate alpha-gustducin, mediate PLC-β2 activation, and subsequently modulate TRPM5 gating.

Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Pan paniscus Taste Receptor Type 2 Member 10 (TAS2R10)?

TAS2R10 is a G protein-coupled receptor (GPCR) belonging to the bitter taste receptor family, specifically expressed in Pan paniscus (bonobo). It functions as a chemosensor that detects bitter compounds in the oral cavity and triggers signaling cascades that ultimately lead to the perception of bitter taste. The full-length protein consists of 307 amino acids with a molecular structure featuring the characteristic seven-transmembrane domain organization typical of GPCRs . As a member of the T2R family, it plays an essential role in the detection of potentially harmful substances, contributing to the evolutionary advantage of avoiding toxic compounds.

How does recombinant TAS2R10 differ from native TAS2R10?

Recombinant TAS2R10 from Pan paniscus is produced in heterologous expression systems (typically E. coli) and includes modifications such as an N-terminal His-tag for purification purposes . These modifications allow for easier isolation and purification but may introduce subtle structural differences compared to the native protein. The recombinant version maintains the complete amino acid sequence (residues 1-307) of the wild-type protein but features additional amino acids corresponding to the affinity tag. While these modifications facilitate research applications, researchers should consider potential impacts on protein folding, activity, or ligand binding when designing experiments and interpreting results.

What is the predicted structural organization of TAS2R10?

TAS2R10, like other bitter taste receptors, is a Class T2 G protein-coupled receptor with a characteristic heptahelical transmembrane domain structure. Based on structural data from related taste receptors, the protein features:

  • An extracellular N-terminus (relatively short)

  • Seven transmembrane domains (TM1-TM7)

  • Three extracellular loops (ECL1-ECL3)

  • Three intracellular loops (ICL1-ICL3)

  • An intracellular C-terminus that interacts with downstream signaling proteins

The ligand-binding pocket is likely formed within the transmembrane bundle, with critical residues facing inward toward the central cavity. The specific arrangement of these domains facilitates the binding of diverse bitter compounds and subsequent G protein activation .

How does TAS2R10 signal transduction work at the molecular level?

TAS2R10 signal transduction follows a G protein-mediated pathway:

  • Binding of bitter ligands to the extracellular/transmembrane binding pocket induces conformational changes in the receptor

  • These conformational changes activate associated heterotrimeric G proteins (primarily gustducin)

  • Activated G proteins dissociate into Gα and Gβγ subunits

  • The Gβγ subunit activates phospholipase C β2 (PLCβ2)

  • PLCβ2 hydrolyzes phosphatidylinositol-4,5-bisphosphate (PIP2) to generate inositol-1,4,5-trisphosphate (IP3) and diacylglycerol (DAG)

  • IP3 triggers calcium release from intracellular stores

  • Elevated calcium activates the transient receptor potential M5 (TRPM5) channel

  • TRPM5 activation leads to membrane depolarization and neurotransmitter release

  • This signaling cascade ultimately transmits bitter taste information to the brain

This process represents the canonical bitter taste signaling pathway, though variations may exist depending on cell type and specific ligands .

What are the optimal storage conditions for recombinant TAS2R10?

For maximum stability and activity, recombinant Pan paniscus TAS2R10 should be stored according to these guidelines:

  • Long-term storage: -20°C or preferably -80°C

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles (prepare single-use aliquots)

  • Store in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

  • For maximized stability, add glycerol to a final concentration of 50%

The lyophilized protein powder should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial .

What is the recommended reconstitution protocol for lyophilized TAS2R10?

For optimal reconstitution of lyophilized recombinant TAS2R10:

  • Centrifuge the vial briefly to collect all material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% recommended)

  • Mix gently until completely dissolved

  • Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Flash-freeze aliquots in liquid nitrogen before storing at -80°C

This protocol ensures maximum protein stability and activity for subsequent experimental applications .

What methods can be used to verify the functionality of recombinant TAS2R10?

Several experimental approaches can verify the functionality of recombinant TAS2R10:

  • Calcium Imaging Assays:

    • Transfect cells (HEK293 or similar) with TAS2R10 and Gα16-gust44 chimeric G protein

    • Load with calcium-sensitive dyes (Fura-2AM or Fluo-4AM)

    • Measure calcium flux upon stimulation with potential ligands

  • BRET/FRET-Based Assays:

    • Create fusion constructs with fluorescent/luminescent proteins

    • Monitor conformational changes upon ligand binding

  • Surface Expression Verification:

    • Immunocytochemistry with antibodies targeting extracellular regions or tags

    • Flow cytometry analysis of surface-expressed receptors

  • G Protein Activation Assays:

    • [35S]GTPγS binding assays

    • cAMP accumulation measurements

    • IP3 production quantification

  • Receptor Internalization Studies:

    • Fluorescence microscopy tracking following ligand exposure

    • Quantification of surface expression changes

Each method offers distinct advantages, and the selection should align with specific research questions and available resources .

How can site-directed mutagenesis be used to identify critical functional residues in TAS2R10?

Site-directed mutagenesis provides a powerful approach for investigating structure-function relationships in TAS2R10. A comprehensive mutagenesis strategy should include:

  • Systematic Transmembrane Domain Scanning:

    • Alanine scanning of each transmembrane domain

    • Focus on conserved residues across species

    • Create point mutations at 10-15 residue intervals throughout the protein

  • Binding Pocket Investigation:

    • Target residues predicted to face the central cavity (based on homology modeling)

    • Conservatively substitute residues (e.g., Phe→Tyr, Asp→Glu) to maintain similar physicochemical properties

    • Create charge-reversal mutations to identify electrostatic interactions

  • G Protein Coupling Analysis:

    • Mutate residues in intracellular loops (particularly ICL3)

    • Focus on basic and aromatic residues often involved in G protein interactions

    • Create truncation mutants of the C-terminus to identify regulatory regions

  • Experimental Validation:

    • Express each mutant in a heterologous system

    • Verify surface expression using confocal microscopy or flow cytometry

    • Assess functional responses using calcium imaging or other signaling assays

    • Determine EC50 values for selected agonists

This systematic approach can identify residues critical for ligand recognition, G protein coupling, and receptor activation, providing insights into the molecular mechanisms of bitter taste perception .

What heterologous expression systems are most effective for functional studies of TAS2R10?

Different heterologous expression systems offer distinct advantages for TAS2R10 functional studies:

Expression SystemAdvantagesLimitationsRecommended Applications
HEK293- High transfection efficiency
- Well-established for GPCR studies
- Compatible with most functional assays
- Non-native cellular environment
- May lack specialized chaperones
- Initial pharmacological characterization
- Mutagenesis studies
- Calcium imaging
CHO-K1- Stable expression possible
- Low endogenous receptor expression
- Consistent glycosylation
- More challenging transfection
- Higher maintenance requirements
- Stable cell line generation
- Binding assays
- High-throughput screening
Sf9 Insect Cells- High protein expression levels
- Suitable for structural studies
- Better membrane protein folding
- Different glycosylation patterns
- More complex cultivation
- Protein purification
- Structural studies
- Radioligand binding assays
Xenopus Oocytes- Large cell size for electrophysiology
- Well-suited for ion channel coupling studies
- Specialized equipment needed
- Lower throughput
- Electrophysiological recordings
- Ion channel coupling studies

For most functional studies, HEK293 cells co-transfected with TAS2R10 and a chimeric G protein (such as Gα16-gust44) represent the optimal system, balancing ease of use with physiological relevance .

How does the protein stability of recombinant TAS2R10 compare in different detergent environments?

Membrane protein stability is critically dependent on the detergent environment. For TAS2R10, various detergents offer different stability profiles:

Detergent ClassExamplesStability ImpactRecommended ConcentrationApplications
MaltosidesDDM, UDMModerate to high stability0.05-0.1% (w/v)General purification, ligand binding studies
GlucosidesOG, NGLower stability, smaller micelles0.5-1.0% (w/v)Short-term applications, crystallization trials
Neopentyl GlycolsLMNGEnhanced stability0.01-0.02% (w/v)Long-term stability, structural studies
Facial AmphiphilesMNA-C12Variable, potentially stabilizing0.1-0.2% (w/v)Novel applications, challenging receptors
Steroid-basedDigitonin, GDNHigh stability for many GPCRs0.1% (w/v)Cryo-EM sample preparation

Based on studies with related bitter taste receptors, a combination approach often yields optimal results:

  • Initial extraction with 1% (w/v) DDM

  • Buffer exchange to 0.1% (w/v) DDM + 0.01% (w/v) CHS

  • Final stabilization in 0.01% (w/v) LMNG + 0.001% (w/v) CHS

Thermal stability assays (TSA) and size-exclusion chromatography can be used to empirically determine the optimal detergent conditions for specific experimental applications .

How does Pan paniscus TAS2R10 compare structurally and functionally to human TAS2R10?

Pan paniscus (bonobo) and human TAS2R10 share high sequence homology reflecting their recent evolutionary divergence:

The high degree of conservation suggests similar bitter compound recognition profiles, though subtle differences may exist in ligand sensitivity or specificity. Comparative functional studies could reveal species-specific adaptations in bitter taste perception related to dietary specialization or toxin avoidance behaviors .

What evolutionary insights can be gained from studying Pan paniscus TAS2R10?

Evolutionary analysis of Pan paniscus TAS2R10 provides valuable insights into primate bitter taste perception:

  • Dietary Adaptation Signatures:

    • Comparison of selective pressures on TAS2R10 across primate species can reveal correlations with dietary preferences

    • Analysis of non-synonymous/synonymous substitution ratios (dN/dS) can identify regions under positive or purifying selection

  • Ecological Niche Specialization:

    • Functional differences between Pan paniscus and other primate TAS2R10 may reflect adaptations to specific plant-derived toxins in their respective habitats

    • Population genetics studies can reveal intraspecies variations correlated with regional dietary differences

  • Comparative Receptor Evolution:

    • Comparing evolutionary rates across TAS2R family members provides insights into receptor specialization

    • Identification of highly conserved residues across species highlights functionally critical amino acids

  • Human-Specific Adaptations:

    • Differences between human and Pan paniscus TAS2R10 may reflect divergent dietary pressures following evolutionary split

    • These differences could correlate with human dietary expansion and cooking technologies

Evolutionary analyses should incorporate multiple TAS2R family members across diverse primate species to provide a comprehensive understanding of bitter taste receptor evolution in relation to dietary adaptations and toxin avoidance strategies .

How can computational approaches predict functional differences between Pan paniscus and human TAS2R10?

Computational approaches provide powerful tools for predicting functional differences between closely related receptors:

  • Homology Modeling and Molecular Dynamics:

    • Generate 3D structural models of both receptors based on available GPCR structures

    • Conduct extended molecular dynamics simulations (>100 ns) to identify conformational differences

    • Analyze binding pocket volume and electrostatic properties

  • Molecular Docking Studies:

    • Dock diverse bitter compounds to both receptor models

    • Calculate binding energies and identify key interaction residues

    • Predict species-specific ligand preferences

  • Sequence-Based Prediction Algorithms:

    • Apply machine learning approaches trained on known GPCR-ligand interactions

    • Identify subtle sequence patterns that may impact function

    • Predict G protein coupling efficiency based on intracellular domain sequences

  • Evolutionary Rate Analysis:

    • Calculate site-specific evolutionary rates across primate TAS2R10 sequences

    • Identify accelerated evolution at specific positions suggesting functional divergence

    • Correlate with predicted structural elements

A comprehensive computational workflow combining these approaches can guide experimental design by identifying the most promising targets for mutagenesis and functional characterization studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.