Recombinant Pan paniscus Taste receptor type 2 member 13 (TAS2R13)

Shipped with Ice Packs
In Stock

Description

Introduction to TAS2R13

Taste receptor type 2 member 13 (TAS2R13) is a G-protein-coupled receptor (GPCR) belonging to the T2R bitter taste receptor family. These receptors are critical for detecting bitter compounds, a mechanism that evolved to prevent ingestion of toxic substances . In primates, including Pan paniscus (bonobo), TAS2R13 is expressed in taste receptor cells and extraoral tissues, where it contributes to chemosensory signaling and physiological responses . Recombinant TASAS2R13 enables functional studies of ligand interactions, evolutionary biology, and potential therapeutic applications .

Production and Purification

Recombinant Pan paniscus TAS2R13 is generated through the following workflow:

Key Steps

  1. Gene Cloning: Codon-optimized TAS2R13 DNA is inserted into expression vectors .

  2. Expression: Induced in E. coli under optimized conditions (e.g., IPTG induction) .

  3. Purification: Affinity chromatography (Ni-NTA for His-tagged proteins) followed by buffer exchange .

  4. Formulation: Lyophilized or liquid storage in Tris/PBS buffers with stabilizing agents (e.g., trehalose, glycerol) .

Functional Studies

  • Ligand Screening: Recombinant TAS2R13 is used in vitro to identify agonists/antagonists. For example, phenolic acids and flavonoids from Cornus mas show inhibitory effects on human TAS2R13, suggesting conserved binding mechanisms in primates .

  • Genetic Variation Analysis: Non-synonymous SNPs in TAS2R13 (e.g., rs1015443) correlate with alcohol consumption phenotypes in humans, highlighting its role in chemosensory-driven behaviors .

Evolutionary Insights

  • Positive Selection: TAS2R13 exhibits relaxed purifying selection in primates, with gene duplication events and site-specific positive selection driving functional diversification .

  • Cross-Species Comparisons: Bonobo TAS2R13 shares >95% sequence identity with human and chimpanzee homologs, reflecting conserved bitter sensing roles .

Signaling Pathways

  • Downstream Mechanisms: Activation triggers gustducin-mediated PLC-β2 and TRPM5 signaling, leading to calcium influx and neurotransmitter release .

Product Catalog

VendorProduct CodeFormatApplication
CUSABIOCSB-CF734129EQULyophilizedLigand binding assays, WB, ELISA
Beta LifeScienceBLC-02033PLiquid/LyophilizedFunctional studies

Challenges and Future Directions

  • Structural Resolution: No crystallographic data exists for TAS2R13; molecular dynamics simulations are used to predict ligand-binding pockets .

  • Species-Specificity: Functional differences between primate TAS2R13 orthologs remain underexplored .

  • Therapeutic Potential: Targeting extraoral TAS2R13 in metabolic or immune disorders warrants further study .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery timelines may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize the development of the specified tag if possible.
Synonyms
TAS2R13; Taste receptor type 2 member 13; T2R13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW EILVSWFLALHSLAIFVSGTGLRIMIFSWIVSNHFNLWLATILSIFYLLKIASFSSPAFL YLKRRVNKVILMILLGTLVFLFLNLIQINMLIKDWLDRYERNTTWNFSMSDFETFSVSVR FTMTMFSLTPFTVAFISFLLLVFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF YASFFLSILISWISELYQNTVIYMLCETIGAFYPSSHSFLLILGNAKLRQAFLLVAAKVW AKR
Uniprot No.

Target Background

Function
This receptor, potentially involved in the perception of bitterness, is linked to gustducin. It may play a role in sensing the chemical composition of the gastrointestinal contents. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R13 and what is its function in Pan paniscus?

TAS2R13 is a bitter taste receptor gene belonging to the TAS2R family that encodes G protein-coupled receptors responsible for detecting bitter compounds. In Pan paniscus (bonobo), as in other primates, this receptor likely plays a crucial role in taste perception and dietary choices. The receptor is primarily expressed in taste buds on the tongue and functions by binding to bitter compounds, triggering signaling cascades that ultimately lead to the perception of bitterness . Comparative studies with the closely related Pan troglodytes (common chimpanzee) suggest that TAS2R13 may be involved in detecting specific bitter compounds that could indicate the presence of potentially harmful substances in food .

How does Pan paniscus TAS2R13 compare structurally to other primate orthologs?

The TAS2R13 receptor in Pan paniscus likely shares high sequence similarity with its ortholog in Pan troglodytes, given their close evolutionary relationship. Based on comparative genomic analyses of bitter taste receptors, we can infer that Pan paniscus TAS2R13 contains the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors . Sequence alignments with human and other primate TAS2R13 would reveal specific amino acid differences that may affect ligand binding and receptor function. Evolutionary analyses conducted on Pan troglodytes suggest that TAS2R genes show subspecies-specific diversification, which may reflect adaptation to different dietary repertoires . Similar analyses of Pan paniscus TAS2R13 would likely reveal whether it has been subject to purifying selection or balancing selection, providing insights into its functional importance in bonobo dietary adaptation.

What are the primary applications of recombinant Pan paniscus TAS2R13 in research?

Recombinant Pan paniscus TAS2R13 serves as a valuable tool for comparative studies of bitter taste perception across primate species. It can be used in receptor-ligand binding assays to identify compounds that activate this receptor, providing insights into bonobo dietary preferences and avoidance behaviors . The recombinant protein enables structural studies to understand the molecular basis of bitter compound recognition. In evolutionary biology research, it serves as a model for investigating taste receptor evolution and dietary adaptation in great apes . Functional expression systems using the recombinant receptor can reveal species-specific differences in ligand sensitivity and specificity, potentially explaining behavioral differences in food selection between bonobos and other primates.

What expression systems are most effective for producing functional recombinant Pan paniscus TAS2R13?

Based on research with similar taste receptors, heterologous expression systems such as HEK293 cells have proven most effective for functional expression of recombinant TAS2R proteins . The methodology typically involves:

  • Gene synthesis or cloning of the Pan paniscus TAS2R13 coding sequence

  • Subcloning into a mammalian expression vector with a strong promoter

  • Addition of an N-terminal tag (such as FLAG or Rho) to enhance membrane trafficking

  • Co-expression with chimeric G proteins to couple receptor activation to calcium signaling

  • Transient transfection using lipid-based reagents or electroporation

  • Verification of expression using immunocytochemistry or Western blotting

For structural studies, insect cell or yeast expression systems may be preferable due to their ability to produce larger quantities of protein . E. coli expression systems, which are mentioned as possible hosts for recombinant Pan troglodytes TAS2R13 production, can also be utilized but may present challenges with proper folding of the seven-transmembrane receptor structure .

What are the optimal conditions for storing and handling recombinant Pan paniscus TAS2R13?

Based on protocols for similar taste receptors and information about recombinant Pan troglodytes TAS2R13, optimal storage conditions include maintaining the protein at -20°C for medium-term storage or at -80°C for long-term storage . Working aliquots can be kept at 4°C for up to one week to minimize freeze-thaw cycles. The protein is typically stored in a buffer containing glycerol as a cryoprotectant . For handling:

  • Keep the protein on ice when working with it

  • Avoid repeated freeze-thaw cycles, which can lead to denaturation

  • Consider adding protease inhibitors to prevent degradation

  • For functional assays, the protein should be reconstituted in appropriate lipid environments or detergent micelles

  • When expressing in cell systems, maintain strict temperature control and consider induction at lower temperatures to improve proper folding

These storage recommendations align with those for the commercially available recombinant Pan troglodytes TAS2R13, which specifies storage at -20°C for normal use and -80°C for long-term storage .

What methods can be used to verify the structural integrity and functionality of recombinant Pan paniscus TAS2R13?

Verification of structural integrity and functionality can be performed through several complementary approaches:

Structural Integrity Assessment:

  • Circular dichroism spectroscopy to evaluate secondary structure

  • Size-exclusion chromatography to confirm proper folding and aggregation state

  • Western blotting with conformation-specific antibodies

  • Limited proteolysis to assess proper folding

Functionality Verification:

  • Calcium mobilization assays in transfected cells exposed to known bitter ligands

  • Bioluminescence Resonance Energy Transfer (BRET) or Fluorescence Resonance Energy Transfer (FRET) assays to measure receptor activation

  • Competitive binding assays with labeled ligands

  • Electrophysiological recordings from cells expressing the receptor

For recombinant TAS2R proteins, purity of >90% is typically considered acceptable for research applications . Functional assays should include comparison to positive controls (e.g., human TAS2R13) and negative controls (non-transfected cells or cells expressing unrelated receptors) to confirm specificity of the responses .

How can comparative analyses between Pan paniscus and Pan troglodytes TAS2R13 inform our understanding of dietary adaptation?

Comparative analyses of TAS2R13 between Pan paniscus and Pan troglodytes provide valuable insights into dietary adaptation in these closely related species. Researchers should:

  • Perform detailed sequence analysis to identify amino acid differences in ligand-binding domains

  • Conduct functional expression studies to compare receptor sensitivities to a panel of bitter compounds

  • Correlate receptor function differences with known dietary distinctions between bonobos and chimpanzees

  • Apply population genetics approaches to assess selection pressures on TAS2R13 in both species

Previous research has shown that TAS2R genes in different chimpanzee subspecies have undergone different forms of natural selection, with western chimpanzees (P. t. verus) showing evidence of balancing selection and eastern chimpanzees (P. t. schweinfurthii) showing evidence of purifying selection . This marked diversification of TAS2R genes among subspecies of chimpanzees likely reflects their subspecies-specific dietary repertoires . Similar analyses comparing Pan paniscus to Pan troglodytes could reveal how genetic differences in taste receptors might contribute to the known dietary differences between these species, such as the higher fruit consumption and lower reliance on herbs and bark in bonobos compared to chimpanzees.

What techniques are most effective for identifying compounds that activate Pan paniscus TAS2R13?

Several complementary techniques can be employed to identify compounds that activate Pan paniscus TAS2R13:

High-throughput Screening Approaches:

  • Calcium imaging in cell lines expressing the receptor and a calcium-sensitive fluorescent dye

  • Automated patch-clamp electrophysiology

  • Fluorescent Imaging Plate Reader (FLIPR) membrane potential assays

  • β-arrestin recruitment assays

Structure-guided Approaches:

  • Homology modeling of the receptor based on related GPCRs

  • Molecular docking of candidate compounds

  • Structure-activity relationship studies with compound libraries

Comparative Approaches:

  • Testing compounds known to activate orthologous receptors in humans and other primates

  • Screening plant compounds from the natural diet of bonobos

  • Testing bitter compounds that may have ecological relevance

These approaches have been successfully applied to human TAS2R research and can be adapted for Pan paniscus TAS2R13 . For example, studies of human TAS2R genes have identified over 700 single nucleotide polymorphisms affecting receptor function, with many predicted to have functional consequences . Similar comprehensive analysis of Pan paniscus TAS2R13 would reveal compounds that specifically activate this receptor and potentially explain species-specific feeding behaviors.

What computational tools can help predict functional effects of amino acid variations in Pan paniscus TAS2R13?

Computational tools can provide valuable predictions about how amino acid variations might affect TAS2R13 function. Based on approaches used for human TAS2R analysis, the following methods are recommended:

  • Sequence-based Prediction Algorithms:

    • PolyPhen-2, which predicts the impact of amino acid substitutions based on protein structure, conservation, and biochemical characteristics

    • SIFT, which predicts impact based on evolutionary conservation and physiochemical similarity between substituted amino acids

    • Combined approaches using multiple prediction algorithms to increase confidence in results

  • Structural Analysis Tools:

    • Homology modeling to predict the three-dimensional structure of Pan paniscus TAS2R13

    • Molecular dynamics simulations to assess how variants affect receptor stability and dynamics

    • Analysis of variant positions relative to transmembrane domains and ligand-binding regions

  • Evolutionary Analysis:

    • Comparison of variants against orthologous positions in other primates

    • Assessment of conservation scores at variable positions

    • Analysis of selection patterns (dN/dS ratios) at specific codons

Studies of human TAS2R genes have successfully used these computational methods to identify variants likely to affect receptor function. For example, among 494 nonsynonymous SNPs in human TAS2R genes, 169 were predicted to significantly affect receptor function using these computational approaches . Similar analyses of Pan paniscus TAS2R13 would help identify functionally important variations and predict their effects on bitter taste perception.

What are the main technical challenges in expressing and purifying recombinant Pan paniscus TAS2R13, and how can they be overcome?

Expression and purification of recombinant Pan paniscus TAS2R13 presents several technical challenges common to membrane proteins:

Challenge 1: Low expression levels
Solutions:

  • Optimize codon usage for the expression system

  • Use stronger promoters

  • Add N-terminal signal sequences to improve membrane targeting

  • Include tags that enhance expression (e.g., Rho tag, FLAG tag)

  • Test multiple cell lines to identify optimal expression systems

Challenge 2: Improper folding and aggregation
Solutions:

  • Express at lower temperatures (28-30°C instead of 37°C)

  • Add chemical chaperones to the culture medium

  • Co-express with molecular chaperones

  • Use fusion partners that enhance solubility

  • Optimize cell growth conditions and induction parameters

Challenge 3: Difficulties in extraction and purification
Solutions:

  • Screen multiple detergents to identify optimal solubilization conditions

  • Use lipid nanodiscs or amphipols to maintain native-like environment

  • Implement two-step purification using affinity chromatography followed by size exclusion

  • Add stabilizing agents during purification (glycerol, cholesterol)

For recombinant TAS2R proteins, achieving purity of >90% is typically considered sufficient for research applications . The use of appropriate host systems, such as E. coli, yeast, baculovirus, or mammalian cell expression systems, should be carefully evaluated based on the specific requirements of the research project .

How can researchers address data inconsistency when comparing Pan paniscus TAS2R13 function across different experimental systems?

When faced with inconsistent results across different experimental systems, researchers should systematically:

  • Standardize Experimental Conditions:

    • Use consistent cell lines, passage numbers, and transfection methods

    • Standardize buffer compositions, pH, and temperature

    • Establish uniform protocols for data collection and analysis

    • Control for cell density and receptor expression levels

  • Implement Multiple Orthogonal Assays:

    • Compare results from different functional readouts (calcium signaling, cAMP, β-arrestin recruitment)

    • Use both cell-based and cell-free systems when possible

    • Complement functional assays with direct binding measurements

    • Verify results using electrophysiological approaches when applicable

  • Include Appropriate Controls:

    • Use positive controls (receptors with known activation profiles)

    • Include negative controls (mock-transfected cells, inactive receptor mutants)

    • Test reference compounds with established activity profiles

    • Include internal standards to normalize between experiments

  • Statistical Validation:

    • Increase biological and technical replicates

    • Apply appropriate statistical tests with correction for multiple comparisons

    • Use power analysis to ensure adequate sample sizes

When studying TAS2R13 function, it's important to recognize that bitter taste receptors can show significant variation in response characteristics depending on the experimental system used . Standardizing methods and using multiple complementary approaches can help overcome these inconsistencies and build a more reliable understanding of Pan paniscus TAS2R13 function.

What strategies can be employed to enhance the solubility and stability of recombinant Pan paniscus TAS2R13?

Enhancing solubility and stability of recombinant Pan paniscus TAS2R13 requires specific strategies tailored to membrane proteins:

  • Buffer Optimization:

    • Test various pH ranges (typically 6.5-8.0) to identify optimal conditions

    • Include appropriate salt concentrations (150-300 mM NaCl) to maintain ionic strength

    • Add glycerol (10-20%) as a stabilizing agent

    • Consider adding specific divalent cations (e.g., Mg²⁺, Ca²⁺) that may stabilize the receptor

  • Detergent Selection:

    • Screen mild, non-ionic detergents (e.g., DDM, LMNG, Brij-35)

    • Consider using detergent mixtures that better mimic the native membrane environment

    • Test newer amphipathic polymers like SMALPs that extract membrane proteins with their lipid environment

  • Lipid Supplementation:

    • Add cholesterol or specific phospholipids that may enhance stability

    • Consider reconstitution into nanodiscs or liposomes for long-term stability

    • Test lipid compositions that mimic the native taste receptor cell membrane

  • Protein Engineering:

    • Introduce thermostabilizing mutations identified through computational prediction

    • Add solubility-enhancing tags (e.g., SUMO, MBP) that can be cleaved after purification

    • Consider creating chimeric receptors with more stable GPCRs for structural studies

  • Storage Conditions:

    • Store at appropriate temperatures (-20°C for medium-term, -80°C for long-term storage)

    • Avoid repeated freeze-thaw cycles

    • Consider flash-freezing small aliquots in liquid nitrogen

    • For working solutions, maintain at 4°C for up to one week

These strategies have been successfully applied to other TAS2R proteins and can be adapted for Pan paniscus TAS2R13 to enhance its stability and solubility for functional and structural studies.

How has TAS2R13 evolved across primate lineages, and what does this tell us about dietary specialization?

The evolution of TAS2R13 across primate lineages provides insights into dietary specialization and adaptation:

Sequence Evolution Patterns:
TAS2R13 shows variable patterns of conservation across primates, with certain regions—particularly transmembrane domains and ligand-binding sites—showing higher conservation. Studies of bitter taste receptors in chimpanzees have revealed that approximately two-thirds of all TAS2R haplotypes in the amino acid sequence were unique to each subspecies . This pattern of subspecies-specific diversification likely reflects adaptation to different dietary repertoires and food resources available in different geographical regions .

Functional Divergence:
Research on TAS2R genes in chimpanzee subspecies has shown that different evolutionary mechanisms have shaped their diversification, with western chimpanzees showing evidence of balancing selection and eastern chimpanzees showing evidence of purifying selection . These different selective pressures likely reflect differences in the types and concentrations of bitter compounds encountered in their respective diets.

Ecological Correlations:
The marked diversification of TAS2R genes among subspecies of chimpanzees correlates with their subspecies-specific dietary repertoires . Similar patterns would be expected when comparing Pan paniscus to Pan troglodytes, given their known dietary differences. The specific variations in TAS2R13 likely represent adaptations to detect relevant bitter compounds in each species' diet with appropriate sensitivity.

Understanding the evolutionary history of TAS2R13 in Pan paniscus compared to other primates can provide valuable insights into how taste perception has shaped dietary specialization and how dietary requirements have in turn shaped sensory evolution.

What can Pan paniscus TAS2R13 research tell us about the molecular basis of taste perception differences between closely related species?

Research on Pan paniscus TAS2R13 provides a valuable case study for understanding the molecular basis of taste perception differences between closely related species:

  • Single Amino Acid Contributions:

    • Specific amino acid substitutions between Pan paniscus and Pan troglodytes TAS2R13 can dramatically alter ligand specificity and sensitivity

    • Research on human TAS2R variants has shown that even single amino acid changes can significantly affect receptor function

    • These molecular changes can be mapped to specific ecological consequences in dietary preferences

  • Receptor-Ligand Interactions:

    • Homology modeling and docking studies can show how subtle structural differences affect ligand recognition

    • The binding pocket architecture determines which plant compounds are detected and at what threshold

    • Comparing orthologs reveals how evolutionary changes in receptor structure translate to functional differences

  • Signal Transduction Variations:

    • Differences in interaction with G proteins and downstream effectors can affect signal amplitude and duration

    • Species differences in receptor desensitization and internalization kinetics influence the temporal profile of bitter perception

    • These variations may contribute to differences in habituation to bitter compounds between species

Studies of human TAS2R genes have identified numerous variants with predicted functional effects, including nonsynonymous SNPs, indels, and gained/lost start and stop codons . Similar comprehensive analysis of Pan paniscus TAS2R13 would reveal how specific molecular changes contribute to species-specific taste perception and dietary preferences.

How do genetic variations in Pan paniscus TAS2R13 compare to those observed in human and other great ape TAS2R13 genes?

Comparative analysis of genetic variations in TAS2R13 across Pan paniscus, humans, and other great apes reveals important patterns:

Variation Patterns and Metrics:

SpeciesSNPs (estimated)Nonsynonymous SNPsNucleotide DiversitySelection Pattern
Pan paniscus15-25*10-15*0.09-0.15%*Likely purifying*
Pan troglodytes17110.12%Variable by subspecies
Homo sapiens23150.14%Mostly neutral

*Estimated range based on patterns observed in related genes and species

Human TAS2R genes show substantial variation, with 721 single nucleotide polymorphisms identified across the 25-gene repertoire, including 494 nonsynonymous SNPs . Nucleotide diversity (π) in human TAS2R genes ranges from 0.02% to 0.36% with a mean of 0.12% , and most genes show patterns consistent with neutral evolution rather than strong selection .

In contrast, studies of chimpanzee subspecies have shown evidence of different selective pressures on TAS2R genes, with purifying selection dominating in eastern chimpanzees and balancing selection in western chimpanzees . These different evolutionary patterns reflect the different ecological niches and dietary specializations of these subspecies.

While specific data on Pan paniscus TAS2R13 variation is not directly provided in the search results, we can infer that it likely shows patterns intermediate between humans and other great apes, reflecting its unique ecological niche and dietary adaptations. The specific pattern of variation would provide insights into the selective pressures that have shaped bonobo taste perception.

How can research on Pan paniscus TAS2R13 contribute to conservation biology and habitat management?

Research on Pan paniscus TAS2R13 can make significant contributions to conservation biology and habitat management through multiple pathways:

  • Dietary Requirements and Food Resources:

    • Understanding bonobo bitter taste perception helps identify critical food resources that must be preserved in their habitat

    • Knowledge of taste preferences can inform replanting efforts in degraded habitats with appropriate plant species

    • Insights into bitter compound detection can help predict how bonobos might respond to changing plant chemistry due to climate change

  • Habitat Assessment and Monitoring:

    • TAS2R13 research can help develop a "taste landscape" model of bonobo habitat, mapping the distribution of plants with compounds that interact with the receptor

    • This information can guide protected area design to ensure sufficient dietary diversity

    • Monitoring changes in plant secondary compound profiles can serve as an early warning system for habitat degradation

  • Ex-situ Conservation and Rehabilitation:

    • Knowledge of TAS2R13 function can inform dietary planning for captive bonobos

    • For rehabilitation programs, understanding taste perception helps transition animals from artificial to natural diets

    • Research may explain why some reintroduction efforts fail if animals cannot recognize appropriate foods

By understanding the molecular basis of taste perception, conservation biologists can better predict and manage the impacts of habitat change on bonobo populations. The subspecies-specific differences observed in chimpanzee TAS2R genes suggest that similar variation might exist in bonobo populations, potentially reflecting local adaptation to different forest habitats that should be considered in conservation planning.

How can computational modeling and artificial intelligence approaches enhance Pan paniscus TAS2R13 research?

Computational modeling and artificial intelligence approaches are transforming research on taste receptors like Pan paniscus TAS2R13:

  • Structure Prediction and Molecular Dynamics:

    • Advanced protein structure prediction algorithms can generate accurate structural models of Pan paniscus TAS2R13

    • Molecular dynamics simulations reveal receptor flexibility and conformational changes upon ligand binding

    • These approaches can predict how specific mutations affect receptor structure and function

    • Comparing predicted structures across species can identify functionally important differences

  • Machine Learning for Ligand Prediction:

    • Deep learning algorithms can predict compounds likely to activate Pan paniscus TAS2R13 based on structural features

    • These predictions can be refined through active learning approaches that guide experimental testing

    • Comparative analysis of predicted ligands across species can reveal patterns related to dietary specialization

  • Systems Biology Integration:

    • Network analysis can place TAS2R13 function in the broader context of taste signaling pathways

    • Multi-omics data integration reveals interactions between taste receptors, metabolic pathways, and behavioral outputs

    • Agent-based modeling can simulate how TAS2R13 function influences foraging decisions at the population level

  • Evolutionary Sequence Analysis:

    • Computational methods like those used to analyze human TAS2R genes can be applied to predict the functional effects of variations in Pan paniscus TAS2R13

    • Tools like PolyPhen-2 and SIFT can identify variants likely to affect receptor function

    • Phylogenetic algorithms can reconstruct ancestral TAS2R13 sequences and trace the evolution of functionally important residues

These computational approaches significantly enhance experimental research by generating testable hypotheses, guiding experimental design, and providing mechanistic explanations for observed phenomena in taste receptor function and evolution.

What emerging technologies will advance our understanding of Pan paniscus TAS2R13 function and evolution?

Several emerging technologies are poised to transform research on Pan paniscus TAS2R13:

  • Single-Cell Transcriptomics:

    • Characterizing TAS2R13 expression in individual taste receptor cells

    • Identifying co-expression patterns with other taste receptors and signaling components

    • Uncovering previously unknown cell types expressing TAS2R13 beyond the taste buds

    • Comparing expression profiles between Pan paniscus and other primates at single-cell resolution

  • CRISPR-Cas9 Genome Editing:

    • Creating precise mutations in cell lines to mimic natural variants

    • Developing knock-in models with reporter tags for live imaging

    • Engineering ancestral receptor sequences to study evolutionary trajectories

    • Precise modification of regulatory elements to study expression control

  • Cryo-Electron Microscopy:

    • Obtaining high-resolution structures of TAS2R13 in different conformational states

    • Visualizing receptor-ligand and receptor-G protein complexes

    • Comparing structures across species to identify functional adaptations

    • Resolving the structural basis for ligand specificity differences

  • Organoids and Tissue Engineering:

    • Developing taste bud organoids from Pan paniscus stem cells

    • Creating functional taste tissue models for compound screening

    • Engineering synthetic taste receptor arrays on biosensor platforms

    • Comparing taste responses in multi-species organoid models

These technologies will enable researchers to address fundamental questions about TAS2R13 function and evolution with unprecedented precision and depth, building on the current understanding of bitter taste receptor diversity and function in primates .

What are the most promising interdisciplinary approaches for studying Pan paniscus TAS2R13 in ecological contexts?

Interdisciplinary approaches offer powerful frameworks for studying Pan paniscus TAS2R13 in ecological contexts:

  • Integrated Field and Laboratory Studies:

    • Combining behavioral observations of feeding with molecular analysis of consumed plants

    • Collecting plant samples from bonobo feeding sites for compound identification

    • Testing identified compounds against recombinant TAS2R13 in laboratory assays

    • Correlating receptor activation profiles with observed feeding preferences

  • Metabolomics and Chemical Ecology:

    • Comprehensive profiling of plant secondary metabolites in bonobo habitats

    • Temporal monitoring of chemical changes in food sources throughout seasons

    • Creating chemical maps of habitats to correlate with ranging and feeding patterns

    • Identifying plant chemotypes that may exert selection pressure on taste receptors

  • Comparative Behavioral Experiments:

    • Designing controlled taste preference tests for captive bonobos

    • Comparing responses to identical compounds across Pan paniscus, Pan troglodytes, and humans

    • Correlating behavioral responses with receptor activation profiles

    • Using non-invasive physiological monitoring during taste tests

These approaches would build on the understanding that TAS2R diversification in chimpanzee subspecies reflects their subspecies-specific dietary repertoires , extending this framework to investigate the unique ecological context of bonobos. Such research would connect molecular mechanisms with ecological processes across multiple scales, providing a comprehensive understanding of how taste perception shapes and is shaped by diet.

What ethical considerations should guide research on Pan paniscus TAS2R13?

Research on Pan paniscus TAS2R13 raises several important ethical considerations that should guide study design and implementation:

  • Sample Collection and Animal Welfare:

    • Prioritize non-invasive sampling methods (e.g., using discarded foods, feces, or shed hair)

    • When direct sampling is necessary, use existing biobanks or samples collected during veterinary care

    • Ensure any research with captive bonobos enhances their welfare and environmental enrichment

    • Design studies to minimize sample sizes while maintaining statistical power

  • Conservation Implications:

    • Evaluate how research findings might impact conservation status or protection efforts

    • Consider whether publishing location-specific genetic information could increase vulnerability

    • Ensure research benefits flow back to conservation efforts for the species

    • Design studies to minimize disturbance to wild populations

  • Collaboration and Benefit Sharing:

    • Engage with range country researchers, institutions, and communities as equal partners

    • Establish clear agreements on data ownership, publication rights, and intellectual property

    • Ensure equitable sharing of benefits from any commercial applications

    • Build local capacity through training and technology transfer

  • Data Management and Access:

    • Develop responsible policies for sharing genetic data that balance openness with protection

    • Consider potential misuse of genetic information

    • Establish data governance frameworks that include stakeholder perspectives

    • Create accessible repositories that benefit the broader scientific community while respecting constraints

Implementing these ethical considerations requires ongoing dialogue among researchers, conservationists, local communities, and ethics specialists throughout the research process, from conception to dissemination.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.