Recombinant Pan paniscus Taste receptor type 2 member 14 (TAS2R14)

Shipped with Ice Packs
In Stock

Description

Recombinant TAS2R14 exhibits promiscuous ligand binding, recognizing >150 structurally distinct bitter compounds . Notable ligands include:

LigandSourceBiological Role
Flufenamic acidSynthetic NSAIDGastrointestinal signaling
Saikosaponin bRadix BupleuriAnti-inflammatory, anti-asthma
PiperinePiper nigrumGLP-1 secretion modulation
Aristolochic acidHerbal remedyCarcinogenic, TAS2R14 agonist

Key functional pathways:

  • G-protein signaling: Couples to Gαi or Gαgust, triggering calcium mobilization .

  • Immune modulation: Inhibits IgE-dependent mast cell degranulation .

  • Muscle relaxation: Induces bronchodilation via smooth muscle calcium signaling .

Research Applications and Therapeutic Potential

Recombinant TAS2R14 serves as a critical tool in:

Cancer Research

Studies in human TAS2R14 highlight its downregulation in thyroid cancer (THCA), correlating with improved survival rates . While Pan paniscus data are absent, this suggests potential diagnostic or therapeutic utility.

Cancer TypeTAS2R14 ExpressionClinical Correlation
Papillary thyroid cancer↓ (vs. normal)High survival rate
Tall PTC subtypeDistinct expressionDiagnostic marker potential

Source: Human thyroid cancer studies

Drug Development

  • Allosteric modulation: TAS2R14’s intracellular pocket allows design of dual-binding ligands (e.g., flufenamic acid) .

  • Natural product screening: Identification of saikosaponin b as a TAS2R14 agonist for anti-asthma therapies .

Production and Experimental Use

Recombinant TAS2R14 is typically produced via:

  1. Cloning: Insertion of Pan paniscus TAS2R14 gene into expression vectors (e.g., pcDNA3.1).

  2. Expression: Host systems include E. coli, insect cells, or HEK293 cells .

  3. Purification: Affinity chromatography (e.g., GST-tagged proteins) .

ApplicationMethodOutcome
Ligand binding assaysBRET, calcium fluxEC₅₀ determination
Structural studiesCryo-EM, MD simulationsBinding pocket characterization
Functional validationHEK293-G16gust44 cellsSignal transduction analysis

Evolutionary and Comparative Insights

While direct Pan paniscus TAS2R14 studies are scarce, comparative genomics reveal:

  • Conservation: TAS2R14 gene clusters on chromosome 12p13 in humans and primates .

  • Species-specific SNPs: Polymorphisms (e.g., I118V, rs4140968) may influence ligand affinity and disease susceptibility .

Challenges and Future Directions

  • Limited species-specific data: Most studies focus on human TAS2R14; Pan paniscus models remain underexplored.

  • Therapeutic translation: Challenges include off-target effects and receptor promiscuity .

  • Nutraceutical interactions: TAS2R14’s role in sensing bitter compounds (e.g., piperine) warrants study in dietary interventions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TAS2R14; Taste receptor type 2 member 14; T2R14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISKISLVW LIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFL YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIV LTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKRSGDASTKAHRGVKSMMTFFLLY AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRY MFKDGEPSGHKEFRESS
Uniprot No.

Target Background

Function

This receptor potentially plays a role in bitterness perception and is linked to gustducin. It may also participate in sensing the gastrointestinal tract's chemical composition. Receptor activation may stimulate alpha-gustducin, mediate PLC-beta-2 activation, and subsequently modulate TRPM5 gating.

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R14 and how is it classified within receptor families?

TAS2R14 belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor (GPCR) superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia and are organized in clusters within the genome. In humans, the TAS2R14 gene maps to the taste receptor gene cluster on chromosome 12p13 . Within the broader GPCR classification, TAS2R14 falls into the Class T2 (Taste 2) sensory receptors category, which consists of receptors specifically involved in bitter taste perception.

How does Pan paniscus TAS2R14 compare structurally to human TAS2R14?

Pan paniscus (bonobo) TAS2R14 shares high sequence homology with human TAS2R14, reflecting their close evolutionary relationship. Like other taste receptors, it features the characteristic seven-transmembrane domain structure typical of G-protein-coupled receptors . The receptor's structure includes extracellular loops (ECLs), intracellular loops (ICLs), transmembrane domains (TMs), and N-terminal and C-terminal regions that collectively contribute to its ligand binding and signaling properties. Comparative sequence analysis reveals conserved regions that are likely critical for receptor function, while variable regions may account for species-specific responses to bitter compounds.

What experimental methods are typically used to express recombinant TAS2R14?

Recombinant TAS2R14 can be expressed in various heterologous expression systems, including mammalian cell lines (HEK293, CHO cells), yeast (Saccharomyces cerevisiae), and insect cells (Sf9, High Five). For mammalian expression, the gene is typically cloned into vectors containing strong promoters (CMV, EF1α) and appropriate selection markers. To enhance membrane targeting and expression levels, researchers often use chimeric constructs incorporating the first 45 amino acids of rat somatostatin receptor type 3 at the N-terminus and fusion tags (e.g., FLAG, HA, or His) at the C-terminus for detection and purification purposes . Expression can be verified through Western blotting, immunofluorescence, or flow cytometry using tag-specific antibodies.

What are the key ligands known to activate TAS2R14 in primates?

TAS2R14 responds to a diverse array of bitter compounds, including both natural and synthetic molecules. Among the known activators are flufenamic acid and aristolochic acid, which have been used in structural studies to understand binding mechanisms . The receptor demonstrates promiscuity in ligand recognition, responding to compounds with varied chemical structures, including plant-derived bitter substances (alkaloids, flavonoids) and pharmaceutical agents. This broad activation profile suggests that TAS2R14 may serve as a general detector for potentially harmful substances in the diet, as many bitter compounds are associated with toxicity.

How can researchers optimize purification protocols for functional recombinant TAS2R14?

Optimizing purification of recombinant TAS2R14 requires a multi-step approach that preserves receptor functionality. Begin with careful selection of detergents - mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above CMC are recommended to maintain native protein conformation. Incorporate stabilizing agents such as cholesterol hemisuccinate (CHS) at 0.1-0.2% throughout the purification process, as cholesterol has been observed occupying specific sites in TAS2R14 structures . For affinity purification, a two-step approach using anti-FLAG M2 affinity resin followed by size exclusion chromatography yields higher purity. Receptor stability can be significantly enhanced by performing all purification steps at 4°C and including specific ligands (e.g., flufenamic acid at 10-50 μM) in all buffers to maintain the receptor in a stabilized conformation.

What are the challenges in structural determination of TAS2R14 and how can they be overcome?

Structural determination of TAS2R14 presents several challenges including its inherent conformational flexibility, relatively low expression levels, and instability in detergent solutions. Recent advances have employed cryo-electron microscopy combined with protein engineering approaches to overcome these barriers . Successful strategies include: (1) Thermostabilizing mutations identified through alanine scanning or directed evolution, (2) Creation of fusion constructs with stabilizing proteins such as T4 lysozyme or BRIL inserted into ICL3, (3) Complex formation with nanobodies or antibody fragments that lock the receptor in specific conformations, and (4) Reconstitution into lipid nanodiscs to provide a more native-like membrane environment. Additionally, using the structure of G protein complexes as revealed in recent cryo-EM studies provides a template for designing constructs that stabilize specific functional states of the receptor.

How can molecular dynamics simulations enhance our understanding of TAS2R14 function?

Molecular dynamics (MD) simulations provide crucial insights into TAS2R14 dynamics that static structural data cannot capture. For effective MD studies, researchers should: (1) Construct a complete atomic model including missing loops and side chains using homology modeling based on available cryo-EM structures, (2) Embed the receptor in a realistic membrane composition (e.g., POPC:POPE:cholesterol at 5:5:1 ratio) using tools like CHARMM-GUI, (3) Perform equilibration in multiple steps with gradually decreasing restraints, followed by production runs of at least 500 ns to 1 μs to capture relevant conformational changes, and (4) Apply enhanced sampling techniques such as metadynamics or replica exchange methods to investigate rare events including ligand binding/unbinding pathways. Analysis should focus on identifying allosteric communication networks between the multiple binding pockets unique to TAS2R14, characterizing the dynamics of cholesterol interaction sites, and elucidating the conformational changes that couple ligand binding to G protein activation .

What approaches can be used to study TAS2R14 signaling pathways in heterologous systems?

Investigation of TAS2R14 signaling pathways in heterologous systems requires integrated methodologies targeting multiple aspects of signal transduction. BRET/FRET-based proximity assays using fluorescently tagged receptor and G protein subunits (particularly Gα-gustducin and Gαi) provide real-time measurements of receptor-G protein coupling dynamics with sub-second resolution. Downstream signaling can be monitored through calcium mobilization assays using calcium-sensitive dyes (Fluo-4) or genetically encoded calcium indicators (GCaMP variants), while cAMP levels can be measured using EPAC-based FRET sensors. For comprehensive pathway mapping, phosphoproteomic analysis following receptor activation identifies downstream targets with temporal resolution. Pathway specificity can be validated using selective inhibitors (e.g., PTX for Gαi inhibition) or CRISPR-mediated knockout of signaling components. Importantly, comparative analysis between human and Pan paniscus TAS2R14 signaling should include chimeric receptors to identify species-specific regions responsible for differential signaling properties .

What is known about the unique binding mechanisms of TAS2R14 compared to other GPCRs?

TAS2R14 exhibits a remarkably distinctive binding mechanism compared to canonical GPCRs. Recent cryo-electron microscopy studies have revealed that TAS2R14 agonists bind to multiple intracellular pockets rather than the typical extracellular or transmembrane binding sites observed in most GPCRs . This unusual binding mode may explain the receptor's broad ligand specificity. The binding pockets appear to involve complex interactions between the transmembrane helices, with specific residues creating recognition sites for diverse chemical structures. Additionally, cholesterol molecules occupy specific sites in the TAS2R14 structure, potentially playing a role in stabilizing the receptor conformation or modulating ligand binding. The presence of multiple binding sites suggests an allosteric communication network that translates binding events at different locations into conformational changes that promote G protein coupling.

How does the transmembrane domain organization of TAS2R14 contribute to its function?

The transmembrane domain organization of TAS2R14 features the characteristic seven-transmembrane (7TM) helical bundle common to all GPCRs, but with distinctive arrangements that support its unique functional properties . The TM regions contain specific residues that form the binding pockets for bitter compounds and determine ligand specificity. The arrangement of these helices creates a conformational landscape that allows the receptor to adopt multiple active states depending on the bound ligand. Critical residues in TM3, TM5, and TM6 are likely involved in the transmission of conformational changes from the ligand binding pockets to the intracellular G protein coupling interface. The extracellular loops connecting these transmembrane domains contribute to the initial recognition and filtering of potential ligands, while the intracellular loops and C-terminal region interact with downstream signaling partners, particularly G proteins of the gustducin and Gi subtypes.

What role do extracellular and intracellular loops play in TAS2R14 function?

The extracellular and intracellular loops of TAS2R14 play critical roles in receptor function beyond merely connecting the transmembrane helices. The extracellular loops (ECLs), particularly ECL2 which is the largest and most structurally diverse among bitter taste receptors, form a vestibule that guides potential ligands toward binding pockets and contributes to ligand selectivity . The ECLs contain conserved cysteine residues that form disulfide bonds, stabilizing the receptor's tertiary structure. On the intracellular side, the loops (ICLs) form the interface for G protein interaction, with ICL3 being particularly important for G protein coupling specificity. ICL2 contains a conserved DRY-like motif critical for receptor activation. The structure of these loops determines the receptor's ability to interact with different G protein subtypes, explaining the preferential coupling to gustducin and Gi observed in experimental studies .

How does G protein coupling specificity differ between human and Pan paniscus TAS2R14?

G protein coupling specificity between human and Pan paniscus TAS2R14 shows subtle but potentially significant differences that may reflect evolutionary adaptations to different dietary environments. Both receptors primarily couple to Gα-gustducin and Gαi family members, leading to inhibition of adenylyl cyclase and subsequent decreases in cAMP levels . The coupling interface primarily involves the intracellular ends of TM3, TM5, and TM6, along with ICL2 and ICL3. Species-specific amino acid variations in these regions may alter the efficiency of coupling to different G protein subtypes or affect the kinetics of G protein activation. These differences could translate to variations in bitter taste perception between humans and bonobos, potentially contributing to dietary preferences. Methodologically, these differences can be studied using BRET/FRET-based interaction assays with various G protein subunits, comparative calcium mobilization studies, and chimeric receptor approaches that swap the intracellular regions between the human and Pan paniscus receptors.

How can TAS2R14 research inform our understanding of evolutionary taste adaptations in primates?

Comparative analysis of TAS2R14 across primate species provides a window into the evolutionary forces shaping taste perception. Researchers can employ several methodologies to explore these adaptations: (1) Conduct comprehensive sequence analysis of TAS2R14 orthologs across primate lineages using maximum likelihood methods to identify sites under positive selection, (2) Perform functional characterization of ancestral TAS2R14 sequences reconstructed via phylogenetic methods to trace the evolution of ligand specificity, (3) Correlate receptor variations with ecological and dietary data from primate field studies to identify potential selective pressures, and (4) Use CRISPR-engineered cell lines expressing species-specific TAS2R14 variants to compare activation profiles against panels of plant compounds relevant to primate diets. These approaches reveal how changes in receptor structure correlate with dietary specializations, detoxification capabilities, and food preference behaviors across the primate lineage .

What are the implications of non-gustatory TAS2R14 expression for biomedical research?

The expression of TAS2R14 in non-gustatory tissues suggests broader physiological roles and significant implications for biomedical research . In the respiratory system, TAS2R14 mediates bronchodilation when activated by bitter compounds, presenting potential therapeutic targets for asthma and COPD. In the gastrointestinal tract, the receptor appears to regulate gut motility, nutrient sensing, and incretin hormone release, with implications for metabolic disorders. Researchers investigating these extra-oral functions should employ tissue-specific conditional knockout models, single-cell transcriptomics to identify TAS2R14-expressing cell populations, and ex vivo organ bath studies to characterize tissue-specific responses to receptor agonists. Particularly promising is research into TAS2R14's role in immune regulation, where receptor activation may modulate inflammatory responses through mechanisms that remain to be fully elucidated. The development of tissue-specific transgenic reporter systems allows for real-time monitoring of receptor activation in physiological contexts beyond taste perception.

How can researchers develop selective pharmacological tools for TAS2R14 research?

Developing selective pharmacological tools for TAS2R14 research requires a multifaceted approach combining structural insights with medicinal chemistry. Researchers should follow these methodological steps: (1) Establish structure-activity relationships using the recently determined cryo-EM structures and identified binding pockets as starting points for rational design , (2) Create focused compound libraries that systematically explore chemical space around known agonists like flufenamic acid and aristolochic acid, (3) Employ high-throughput screening using cell-based calcium mobilization assays with counter-screening against related TAS2R subtypes to identify selective compounds, and (4) Develop photoaffinity labeling probes based on identified scaffolds to map precise binding sites. Particular attention should be paid to developing negative allosteric modulators, which are currently lacking but would be valuable for dissecting receptor function in complex tissues. Additionally, researchers should explore the development of biased ligands that selectively activate specific downstream signaling pathways, as these would enable more precise manipulation of TAS2R14 function in experimental settings.

What methodological approaches can reveal the potential therapeutic applications of TAS2R14 targeting?

Exploring the therapeutic potential of TAS2R14 targeting requires integrative approaches spanning from molecular pharmacology to clinical applications. Researchers should implement: (1) High-content phenotypic screening of TAS2R14 modulators in disease-relevant cell types, particularly focusing on respiratory, gastrointestinal, and immune cells where the receptor has demonstrated physiological roles, (2) Development of tissue-selective delivery systems for TAS2R14 modulators to minimize off-target effects in taste tissues, (3) In vivo efficacy studies using humanized mouse models expressing human TAS2R14 variants to better predict clinical outcomes, and (4) Translational biomarker identification studies correlating receptor polymorphisms with disease susceptibility and treatment response. Particularly promising therapeutic applications include bronchodilation for respiratory disorders, anti-inflammatory effects in inflammatory bowel diseases, and chemosensory enhancement approaches for patients with taste disorders or medication adherence issues due to bitter taste aversion . Researchers should also explore the implications of receptor desensitization and tachyphylaxis for long-term therapeutic regimens targeting TAS2R14.

How can researchers overcome stability issues when working with recombinant TAS2R14?

Stability challenges with recombinant TAS2R14 can be addressed through several methodological refinements. First, expression systems should be optimized by incorporating N-terminal signal sequences (e.g., from rhodopsin) and C-terminal ER export signals to improve membrane targeting and folding. Second, stability during purification can be enhanced by careful detergent selection (LMNG or GDN often outperform DDM) supplemented with brain lipid extracts (0.01-0.02%) rather than just CHS alone . Third, researchers should implement thermostability assays (CPM or FSEC-TS) during optimizations to quantitatively assess stability improvements. Fourth, nanobody or monobody screening against the purified receptor can identify stabilizing binding partners for co-crystallization or cryo-EM studies. Finally, computational design approaches that identify and neutralize surface entropy patches or introduce disulfide bonds at regions of high flexibility can significantly enhance expression yields and conformational stability. The addition of specific ligands during all purification steps is particularly important, as the multi-pocket binding mode of TAS2R14 means that occupancy of these sites can cooperatively stabilize the receptor structure.

What are the recommended controls for TAS2R14 functional assays?

Rigorous experimental design for TAS2R14 functional assays requires comprehensive controls to ensure valid interpretation of results. Essential controls include: (1) Empty vector-transfected cells to establish baseline responses and rule out endogenous receptor activation, (2) Positive control receptors with well-characterized signaling profiles (e.g., β2-adrenergic receptor) to validate assay functionality, (3) Inactive receptor mutants (e.g., mutations in the DRY-like motif) to confirm specificity of observed signals, (4) G protein coupling-deficient variants to confirm the signaling pathway, (5) Dose-response curves with reference agonists to establish assay sensitivity and dynamic range, and (6) Antagonist pre-treatment controls to confirm receptor-specific effects. For cell-based assays, researchers should also include controls for cell surface expression levels using flow cytometry or surface ELISA, as variations in trafficking can confound interpretation of functional differences. When comparing human and Pan paniscus variants, matched expression levels are critical, and may require titration of transfection conditions to achieve equivalent surface expression .

How can researchers address data inconsistencies in TAS2R14 pharmacological characterization?

Addressing inconsistencies in TAS2R14 pharmacological data requires systematic methodological standardization and careful consideration of experimental variables. Researchers should: (1) Standardize expression systems and receptor constructs across laboratories, preferably using inducible expression to control receptor density, (2) Establish a panel of reference compounds with consensus EC50/IC50 values to calibrate assay sensitivity between laboratories, (3) Account for potential receptor polymorphisms by sequencing confirmation of all constructs and maintaining detailed records of the exact receptor variants used, (4) Consider the influence of assay format by comparing multiple readouts (calcium mobilization, BRET-based G protein activation, β-arrestin recruitment) for the same ligand-receptor pairs, and (5) Systematically evaluate the impact of environmental factors including temperature, pH, and ionic conditions on receptor pharmacology. Additionally, researchers should investigate ligand-specific biases in signaling pathways and the potential for allosteric interactions between compounds binding to different pockets within TAS2R14 . Collaborative cross-validation between laboratories and the establishment of standardized protocols through organized efforts (similar to the GPCR Consortium) would significantly improve data consistency in the field.

What computational methods are most effective for predicting TAS2R14-ligand interactions?

Effective computational prediction of TAS2R14-ligand interactions requires integrated approaches that address the receptor's unique multi-pocket binding mode. Researchers should implement: (1) Ensemble docking approaches that account for receptor flexibility by using multiple conformational states derived from MD simulations or experimental structures, (2) Fragment-based virtual screening that identifies chemical moieties with high affinity for specific sub-pockets before linking them into larger molecules, (3) Machine learning algorithms trained on existing TAS2R14 ligand datasets to identify pharmacophore features and predict novel scaffolds with enhanced selectivity, and (4) Free energy perturbation methods for accurate binding affinity predictions, particularly for subtle chemical modifications of known binders. Given the recently revealed importance of cholesterol in TAS2R14 structure, simulations should explicitly include these lipid molecules when modeling binding sites . Researchers should also employ Markov state modeling to capture the potential allosteric communication between binding pockets and identify cooperative binding effects. These computational predictions should be systematically validated through experimental binding assays and structure-activity relationship studies to refine predictive models iteratively.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.