Recombinant Pan paniscus Taste receptor type 2 member 16 (TAS2R16)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Pan paniscus TAS2R16 is a full-length, His-tagged protein expressed in E. coli or mammalian cell systems (e.g., HEK293) . It is used to study bitter taste perception mechanisms, ligand-receptor interactions, and evolutionary adaptations in primates. Key features include:

  • Molecular weight: 33,986 Da .

  • Expression hosts: E. coli, HEK293, and other mammalian cells .

  • Tagging: His, Avi, or Fc tags for purification and detection .

Functional Roles and Signaling Pathways

TAS2R16 detects bitter compounds like salicin, initiating a signaling cascade via:

  1. PLCβ2: Triggers intracellular calcium release.

  2. TRPM5: Mediates depolarization of taste cells .

Pathways involving TAS2R16 :

PathwayRelated Proteins
Taste transductionTAS2R40, PLCB2, TRPM5, GNB3
G alpha (i) signalingCCR6, HRH3, CASR
GPCR ligand bindingCHRM4, OXER1, FPR-RS4

Ligand Specificity and Mutagenesis

  • Salicin activation: EC₅₀ values for wild-type TAS2R16 range from 0.3–3.1 mM across primates .

  • Key mutations:

    • W261A: Eliminates salicin response but enhances activation by 4-nitrophenyl-β-glucosides .

    • N96T: Reduces EC₅₀ by 5-fold, increasing sensitivity to β-glucosides .

LigandWild-Type EC₅₀ (mM)W261A EC₅₀ (mM)N96T EC₅₀ (mM)
Salicin0.3–3.1No response0.06–0.6
4-NP-β-mannoside1.20.30.24

Evolutionary Insights

  • Primate diversity: TAS2R16 in Japanese macaques shows 10-fold lower salicin sensitivity than humans .

  • Inverse agonism: Black and ruffed lemurs exhibit TAS2R16 inactivation by arbutin (IC₅₀: 0.31–0.52 mM) .

Applications in Research

  1. Bitter compound screening: Used to identify agonists/antagonists for dietary or pharmaceutical applications .

  2. Evolutionary studies: Comparing receptor function across primates (e.g., bonobo, human, macaque) .

  3. Disease links: Polymorphisms (e.g., N172K) correlate with alcohol dependence and dietary preferences .

Production Systems

Host SystemAdvantagesCitations
E. coliCost-effective, high yield
HEK293 cellsPost-translational modifications, functional assays

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R16; Taste receptor type 2 member 16; T2R16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ WASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKASSFTHHIFLWLRW RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLEKFHQYQFQA HTVALVIPFILFLASTILLMASLTKQIQHHSTGHCNPSMKAHFTALRSLAVLFIVFTSYF LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Uniprot No.

Target Background

Function
This receptor, Taste receptor type 2 member 16 (TAS2R16), may play a role in the perception of bitterness and is linked to gustducin. It may contribute to sensing the chemical composition of gastrointestinal contents. Activation of this receptor can stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Pan paniscus TAS2R16 and how does it compare to human TAS2R16?

TAS2R16 from Pan paniscus (pygmy chimpanzee) is a protein-coding gene classified as a G protein-coupled receptor (GPCR). The gene encodes a 292-amino acid protein that functions as a bitter taste receptor, specifically responding to β-glycoside compounds .

The nucleotide sequence of Pan paniscus TAS2R16 consists of an 876bp open reading frame (ORF) . When comparing this to human TAS2R16, structural analyses reveal high conservation in key transmembrane domains, particularly TM3 and TM7, which form a hydrophobic ligand-binding pocket crucial for recognizing β-glycosides .

Comparative analysis of TAS2R16 across primate species suggests evolutionary conservation of functional domains, particularly those involved in ligand binding. The most critical residues for functionality appear in transmembrane domains, with 90% of functionally important residues clustering within these regions, particularly in TM3 (9 residues) and TM5 (8 residues) .

What expression systems are most effective for producing functional recombinant Pan paniscus TAS2R16?

For functional expression of recombinant Pan paniscus TAS2R16, mammalian cell systems have proven most effective due to their appropriate post-translational modification capabilities and membrane insertion mechanisms for GPCRs. Based on established protocols for TAS2R16 expression:

  • HEK293 cell system: This is the preferred expression system for functional studies, allowing proper trafficking to the cell surface and enabling calcium flux assays to measure receptor activation .

  • Vector selection: The pcDNA3.1+/C-(K)DYK vector or customized vectors with epitope tags (such as V5 or FLAG) enable both detection and functional assessment .

  • Trafficking assessment: N-terminal epitope tags (such as FLAG) are essential for verifying successful cell surface expression, as approximately 88% of TAS2R16 variants successfully traffic to the cell surface at >50% of wild-type levels .

  • Translation verification: C-terminal tags (such as V5) should be used to verify full-length translation, with approximately 91% of TAS2R16 variants showing expression at >50% of wild-type levels .

For calcium mobilization assays, co-expression with a chimeric G protein (e.g., Gα16gust44) is recommended to effectively couple the receptor to calcium signaling pathways for functional readouts .

What are the known ligands for Pan paniscus TAS2R16 and their binding affinities?

Pan paniscus TAS2R16, like its human ortholog, primarily responds to β-glycoside compounds, particularly those with a β-glucose moiety linked to various R-groups. The following ligands have been identified with their relative binding characteristics:

LigandStructure TypeRelative AffinityNotable Features
Salicinβ-glucosideMediumNatural compound found in willow bark
4-nitrophenyl-β-D-glucopyranosideβ-glucosideHighSynthetic compound with nitrophenyl R-group
4-nitrophenyl-β-D-mannopyranosideβ-mannosideMediumDifferent sugar moiety affects binding
Arbutinβ-glucosideMediumNatural compound found in bearberry
Amygdalinβ-gentiobiosideLowCyanogenic glycoside found in bitter almonds

Structure-activity relationship studies reveal that modifications to both the sugar moiety and the R-group significantly impact binding affinity and receptor activation . Notably, 4-nitrophenyl substitutions in the R-group can dramatically alter binding modes, as demonstrated by the differential responses of TAS2R16 mutants (particularly the W261A variant) to these compounds .

The binding pocket formed by hydrophobic residues on TM3 and TM7 accommodates these diverse β-glycoside ligands while maintaining specificity through interactions with key residues positioned on the extracellular side of the transmembrane domains and extracellular loops .

How do specific mutations in Pan paniscus TAS2R16 affect ligand specificity and receptor function?

Comprehensive mutational analysis of TAS2R16 reveals distinct functional categories of residues that influence ligand binding and receptor activation in different ways:

  • Ligand-specific residues: A total of 13 critical residues demonstrate ligand-specific effects (≥2.5-fold difference in activity between different ligands). All of these residues are positioned on the extracellular side of the transmembrane domains or in the extracellular loops .

  • Universally critical residues: 38 residues were identified whose mutation eliminated signal transduction by all β-glycoside ligands tested, suggesting these are essential for general receptor function rather than specific ligand interactions .

  • Position-specific effects: The W261A mutation demonstrates an intriguing pattern where it causes loss-of-function with most ligands but gain-of-function specifically with 4-nitrophenyl-substituted ligands, suggesting alternative binding modes for different ligand classes .

  • Transmembrane clustering: Of the 39 positions where substitution resulted in significantly reduced activation without disrupting surface trafficking, 90% cluster within the transmembrane domains, with the highest concentrations in TM3 (9 residues) and TM5 (8 residues) .

This structure-function mapping provides critical insights for understanding how Pan paniscus TAS2R16 maintains both broad reactivity and high specificity. Many of the identified critical residues are conserved among TAS2R family members, suggesting common mechanisms across bitter taste receptors .

What are the signaling pathways activated by Pan paniscus TAS2R16 and how do they compare to inflammatory pathways?

TAS2R16 activates multiple signaling pathways that extend beyond taste perception to include immunomodulatory functions:

  • Canonical taste signaling: Upon ligand binding, TAS2R16 activates G protein-coupled pathways resulting in calcium mobilization through PLCβ2 activation and subsequent IP3 formation. This pathway is essential for taste perception and can be measured experimentally using calcium flux assays .

  • Anti-inflammatory pathways: Research indicates that TAS2R16 activation can suppress inflammatory responses. For example, TAS2R16 activation by salicin counteracts LPS-induced cytokine production in human gingival fibroblasts by:

    • Reducing intracellular cAMP levels

    • Blocking the NF-κB signaling pathway

  • Intracellular signaling modulators: Activation of TAS2R16 has been shown to trigger various intracellular signaling pathways including the NF-κB pathway, which is crucial in regulating inflammatory responses and tissue homeostasis .

The immunomodulatory role of TAS2R16 suggests evolutionary connections between taste perception and immunity, possibly as a mechanism to detect potentially harmful compounds while simultaneously preparing defensive responses against them. This dual functionality makes TAS2R16 particularly interesting for both evolutionary biology and therapeutic investigations .

How do polymorphisms in the TAS2R16 gene influence receptor function and disease susceptibility?

Several single nucleotide polymorphisms (SNPs) in the TAS2R16 gene have been identified that correlate with altered receptor function and disease susceptibility:

  • rs978739: The C allele of this SNP is less common in non-invasive pituitary adenoma (PA) patients compared to control groups (p = 0.045), suggesting a potential protective effect .

  • rs860170: The CT genotype reduces the likelihood of developing non-invasive pituitary adenoma by approximately 1.9-fold under codominant (p = 0.024) and overdominant (p = 0.030) models. Under the dominant model, the CT+CC genotypes reduce odds by 2-fold (p = 0.021), while each C allele reduces odds by 2-fold under the additive model (p = 0.018) .

  • Serum level correlations: Patients with pituitary adenoma have higher serum levels of TAS2R16 than healthy controls (p < 0.001). Additionally, patients with specific genotypes show distinct patterns:

    • TAS2R16 rs978739 TT or CT genotype carriers have higher serum TAS2R16 levels than healthy individuals (p = 0.025 and p = 0.019, respectively)

    • Those with AA or AG genotype of TAS2R16 rs1357949 had higher protein concentrations (p = 0.005 and p = 0.007, respectively)

These polymorphisms may influence TAS2R16's role in inflammatory modulation, potentially explaining the associations with disease susceptibility. The anti-inflammatory properties of TAS2R16 may provide protection against conditions characterized by chronic inflammation, including certain cancers and inflammatory diseases .

What are the optimal protocols for expressing and purifying recombinant Pan paniscus TAS2R16?

For successful expression and purification of functional recombinant Pan paniscus TAS2R16, a systematic approach is required:

  • Expression system selection:

    • Mammalian expression systems (HEK293 cells) are recommended for functional studies

    • Insect cell systems (Sf9 or High Five) may be suitable for structural studies requiring higher protein yields

    • E. coli systems are not recommended due to poor membrane protein folding

  • Vector design considerations:

    • Include epitope tags to monitor expression (C-terminal V5 tag) and surface trafficking (N-terminal FLAG tag)

    • The pcDNA3.1+/C-(K)DYK vector has been successfully used for TAS2R16 expression

    • Consider codon optimization for the expression host

  • Expression verification protocol:

    • Surface expression: Immunofluorescence or flow cytometry using anti-FLAG antibodies

    • Total expression: Western blotting using anti-V5 antibodies

    • Functional verification: Calcium mobilization assays with co-expressed Gα16gust44

  • Purification strategy:

    • Detergent screening is crucial (typical starting points: DDM, LMNG, or GDN)

    • Two-step purification using affinity chromatography followed by size exclusion chromatography

    • Consider lipid supplementation during purification to maintain stability

When assessing purified protein quality, verify both structural integrity through circular dichroism and functional activity through ligand binding assays using fluorescent ligand analogs or thermal shift assays in the presence of ligands .

What functional assays best characterize the ligand binding and activation properties of Pan paniscus TAS2R16?

Several complementary assays provide comprehensive characterization of TAS2R16 function:

  • Calcium mobilization assays:

    • Primary functional assay for GPCR activation

    • Requires co-expression with chimeric G protein (Gα16gust44)

    • Luminescent (aequorin-based) or fluorescent (Fluo-4) calcium indicators can be used

    • Enables determination of EC50 values and maximal response for various ligands

  • Ligand binding assays:

    • Direct measurement of ligand-receptor interaction

    • Options include fluorescently labeled ligands, competition binding with radiolabeled reference compounds, or surface plasmon resonance

    • Provides KD values to complement functional EC50 data

  • Mutagenesis-based structure-function analysis:

    • Systematic alanine scanning or targeted mutations

    • Essential for mapping binding pocket and activation mechanisms

    • Requires parallel assessment of surface expression and translation to distinguish trafficking defects from binding/signaling defects

  • Intracellular signaling pathway analysis:

    • cAMP measurements to assess Gαi/o coupling

    • NF-κB reporter assays to investigate inflammatory pathway modulation

    • Western blotting for phosphorylated signaling proteins (ERK1/2, p38 MAPK)

For high-throughput screening applications, the calcium mobilization assay represents the most practical approach, while more detailed mechanistic studies require the combination of multiple assay types to distinguish between effects on binding affinity, efficacy, and downstream signaling .

How can evolutionary analysis of TAS2R16 across primates inform our understanding of functional conservation?

Evolutionary analysis of TAS2R16 across primate species provides valuable insights into functional conservation and adaptation:

  • Comparative sequence analysis:

    • Align TAS2R16 sequences from various primate species (human, chimpanzee, bonobo, gorilla, orangutan)

    • Calculate conservation scores for each position

    • Identify regions under positive or purifying selection

    • Correlate with known functional residues

  • Structural mapping approach:

    • Map conserved residues onto structural models

    • Identify conservation patterns in ligand-binding pocket versus structural regions

    • Compare transmembrane domain conservation patterns

  • Functional comparison methodology:

    • Express TAS2R16 from different primate species in identical systems

    • Compare response profiles to the same panel of bitter glycosides

    • Analyze differences in ligand selectivity and sensitivity

    • Correlate with dietary adaptations and ecological niches

  • Polymorphism analysis across populations:

    • Examine population-specific variants within each species

    • Evaluate functional consequences of naturally occurring polymorphisms

    • Perform selection pressure analysis to identify adaptive mutations

This evolutionary approach helps distinguish functionally critical residues (typically highly conserved) from species-specific adaptations (typically variable). The analysis reveals that the core binding pocket formed by hydrophobic residues on TM3 and TM7 shows high conservation, while regions controlling specificity for particular ligands show greater variability, reflecting adaptation to different ecological niches and dietary patterns .

What potential therapeutic applications exist for TAS2R16 modulators based on our understanding of its immunomodulatory functions?

The emerging understanding of TAS2R16's immunomodulatory functions opens several therapeutic avenues:

  • Anti-inflammatory applications:

    • Periodontal disease: TAS2R16 activation by salicin counteracts LPS-induced inflammatory cytokine production in gingival fibroblasts, suggesting potential applications in periodontal therapy

    • Chronic inflammatory conditions: TAS2R16 agonists could potentially modulate NF-κB signaling to suppress excessive inflammation

  • Cancer applications:

    • Pituitary adenoma: Research suggests connections between TAS2R16 polymorphisms and pituitary adenoma susceptibility, indicating potential roles in tumor development or progression

    • Other cancers: Since chronic inflammation often drives cancer progression, and TAS2R16 modulates inflammatory pathways, targeting this receptor might offer novel anti-cancer strategies

  • Drug development considerations:

    • Selective agonists: Design compounds that selectively activate TAS2R16 without bitter taste perception

    • Tissue-specific delivery: Develop delivery systems targeting specific tissues where TAS2R16-mediated anti-inflammatory effects are desired

    • Combination therapies: Explore synergistic effects with established anti-inflammatory agents

  • Potential challenges:

    • Receptor specificity: Ensuring compounds selectively target TAS2R16 without activating other TAS2Rs

    • Tissue accessibility: Developing delivery systems that reach target tissues

    • Balancing immunomodulatory effects without compromising essential inflammatory responses

Future research should focus on identifying the specific signaling mechanisms by which TAS2R16 modulates inflammatory pathways, optimizing selective agonists for this receptor, and developing preclinical models to validate therapeutic efficacy in inflammatory conditions and cancer .

How might CRISPR/Cas9 genome editing be utilized to investigate TAS2R16 function in Pan paniscus models?

CRISPR/Cas9 technology offers powerful approaches for investigating TAS2R16 function in Pan paniscus models:

  • Precise genetic modification strategies:

    • Knock-in of human polymorphisms to create comparative models

    • Introduction of specific mutations identified in structure-function studies

    • Creation of reporter systems by tagging endogenous TAS2R16 with fluorescent proteins

    • Inducible expression systems to control TAS2R16 expression temporally

  • Cell-based models for initial validation:

    • Editing primary Pan paniscus cells (if available) or cell lines

    • Creating isogenic cell lines differing only in TAS2R16 sequence

    • Comparing effects of specific mutations on ligand responses

    • Investigating downstream signaling pathway alterations

  • Experimental design considerations:

    • Target selection: Use evolutionary conservation data to select edit sites

    • Off-target analysis: Thorough computational prediction and experimental verification

    • Phenotypic validation: Comprehensive functional assays for edited models

    • Multi-omics characterization: Transcriptomic, proteomic, and metabolomic profiling

  • Ethical considerations for primate research:

    • Use of cell-based models when possible

    • Application of 3Rs principles (Replacement, Reduction, Refinement)

    • Careful justification of any in vivo studies

These approaches would enable detailed investigation of how specific TAS2R16 residues contribute to ligand binding, signal transduction, and immunomodulatory functions, potentially advancing both basic understanding and therapeutic applications .

What structural biology approaches might overcome the challenges of obtaining high-resolution structures of TAS2R16?

Obtaining high-resolution structures of GPCRs like TAS2R16 presents significant challenges, but several cutting-edge approaches show promise:

  • Stabilization strategies for crystallography:

    • Thermostabilizing mutations based on comprehensive mutation library data

    • Fusion protein approaches (T4 lysozyme or BRIL insertions)

    • Antibody fragment (Fab) or nanobody co-crystallization

    • Lipidic cubic phase crystallization optimized for bitter taste receptors

  • Cryo-electron microscopy approaches:

    • Single-particle analysis of detergent-solubilized receptors

    • Amphipol or nanodisc reconstitution to maintain native-like environment

    • Complexation with G proteins or arrestins to stabilize active conformations

    • Use of high-affinity ligands to stabilize specific conformational states

  • Integrative structural biology:

    • Molecular dynamics simulations based on homology models

    • Refinement using experimental constraints from mutagenesis data

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Cross-linking mass spectrometry to identify spatial relationships between domains

  • Novel approaches for membrane proteins:

    • MicroED (micro-electron diffraction) for small crystals

    • Serial femtosecond crystallography at X-ray free electron lasers

    • Cell-free expression systems with direct incorporation into nanodiscs

The integration of these approaches with the extensive mutagenesis data already available for TAS2R16 would provide unprecedented insights into how this receptor achieves its dual roles in taste perception and immunomodulation, potentially accelerating drug discovery efforts targeting this receptor .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.