Recombinant Pan paniscus Taste receptor type 2 member 20 (TAS2R20)

Shipped with Ice Packs
In Stock

Description

Sequence Characteristics

The TAS2R20 receptor in Pan paniscus consists of 309 amino acids, with a canonical seven-transmembrane (7TM) domain structure typical of GPCRs . Key residues and domains include:

DomainResiduesFunctional Role
N-terminal1–50Ligand-binding initiation
Transmembrane 151–80Signal transduction
Intracellular Loop 2111–120G-protein coupling
Transmembrane 7251–280Agonist specificity
C-terminal281–309Receptor trafficking and regulation

Data derived from GPCRdb .

Genomic Context

TAS2R20 (also designated TAS2R49 in some studies) is part of a rapidly evolving gene family. Comparative analyses reveal:

  • Sequence homology: Shares ~85% amino acid identity with human TAS2R46, a receptor implicated in strychnine detection .

  • Subspecies-specific haplotypes: Two-thirds of Pan paniscus TAS2R20 haplotypes differ from those in common chimpanzees (Pan troglodytes), reflecting dietary adaptations .

Evolutionary Diversification

TAS2R20 exhibits patterns of:

  • Balancing selection: Observed in western chimpanzees, likely driven by dietary diversity .

  • Gene duplication: Amphibian TAS2R expansions (e.g., 39 clusters in Eleutherodactylus coqui) contrast with primate stability, suggesting distinct ecological pressures .

Functional Role

While ligands for recombinant TAS2R20 remain uncharacterized, studies on orthologs suggest:

  • Broad tuning: Human TAS2R46 detects >30 compounds, including strychnine, via its carboxyl-terminal domain .

  • Extra-oral expression: Amphibian TAS2Rs (e.g., in Xenopus tropicalis skin) imply roles beyond taste, such as toxin detection .

Research Tools

Recombinant TAS2R20 enables:

  • Ligand screening: Calcium imaging assays to identify agonists/antagonists .

  • Structural modeling: Homology-based predictions of binding pockets (e.g., residues Y241 and N96 critical for strychnine recognition in TAS2R46) .

Biomedical Relevance

  • Personalized nutrition: Genetic variants in TAS2Rs correlate with bitter sensitivity, influencing dietary choices .

  • Drug discovery: Bitter receptors are targets for modulating metabolic or immune responses .

Knowledge Gaps

  • Ligand specificity: No physiological ligands confirmed for TAS2R20 .

  • Structural data: No experimental structures available; reliance on homology models .

Emerging Opportunities

  • CRISPR-Cas9 mutagenesis: To map functional residues (e.g., chimeric receptors in human studies) .

  • Omics integration: Linking TAS2R20 polymorphisms to Pan paniscus ecological niches .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
TAS2R20; TAS2R49; Taste receptor type 2 member 20; Taste receptor type 2 member 49; T2R49
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLW VILLHWYSTVLNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHH LKRKAKSVVLVIVLGSLFFLVCHLVMKNTYINVWTEECEGNVTWKIKLRNAMHLSNLTVA MLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAI YFLCLITSFWNSKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWQVTCW AKGQNQSTP
Uniprot No.

Target Background

Function
This receptor is involved in the perception of bitterness and is linked to gustducin. It may play a role in sensing the chemical composition of gastrointestinal contents. Activation of this receptor may stimulate alpha gustducin, mediating PLC-beta-2 activation and leading to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R20 and what is its functional significance in Pan paniscus?

TAS2R20 belongs to the TAS2R family of G protein-coupled receptors that function as bitter taste receptors in vertebrates. These receptors play crucial roles in taste perception relevant to primate physiology and behaviors. While specific Pan paniscus TAS2R20 function has not been fully characterized, research on TAS2R receptors indicates they serve as chemosensors that detect bitter compounds, potentially including ecologically important xenobiotics .

Methodological approach: To determine TAS2R20 function, researchers should consider:

  • In vitro receptor activity assays with candidate bitter compounds

  • Comparative analysis with human and chimpanzee TAS2R20 orthologs

  • Expression analysis across various tissues to identify possible extra-oral functions

How does Pan paniscus TAS2R20 compare structurally to orthologs in other primates?

The structural comparison between Pan paniscus TAS2R20 and other primate orthologs requires sequence analysis and structural prediction. TAS2R genes typically exhibit high variability between even closely related species, with few one-to-one orthologs .

Methodological approach:

  • Multiple sequence alignment of TAS2R20 proteins across primates

  • Phylogenetic analysis to determine evolutionary relationships

  • Protein structure prediction using homology modeling

  • Analysis of key functional domains and binding sites

What is the genomic organization of TAS2R20 in Pan paniscus?

TAS2R genes are typically found in clusters in vertebrate genomes. Understanding the genomic context of TAS2R20 in Pan paniscus requires investigation of its chromosomal location and neighboring genes.

Methodological approach:

  • Genome sequence analysis to identify the chromosomal location

  • Analysis of flanking BUSCO genes to identify orthologous loci across species

  • Determination of whether TAS2R20 exists as a singleton or as part of a gene cluster

  • Analysis of proximity to telomeres, as TAS2R genes are often located closer to chromosome ends

What are the expression patterns of TAS2R20 in Pan paniscus?

While specific expression data for Pan paniscus TAS2R20 is limited, research on TAS2Rs indicates they may be expressed in multiple tissues beyond the tongue, with potential extra-oral functions .

Methodological approach:

  • RT-PCR or RNA-seq analysis of multiple tissues

  • In situ hybridization to locate specific cell types expressing TAS2R20

  • Immunohistochemistry using specific antibodies against TAS2R20

  • Single-cell RNA sequencing to identify cell-specific expression patterns

How does TAS2R20 contribute to bitter taste perception in Pan paniscus?

Understanding the role of TAS2R20 in bitter taste perception requires functional characterization of its ligand specificity and signaling properties.

Methodological approach:

  • Calcium imaging assays using cells expressing recombinant TAS2R20

  • Dose-response relationships for known bitter compounds

  • Comparison with human TAS2R20 responses to the same compounds

  • Correlation of genetic variations with behavioral responses to bitter compounds

What are the optimal conditions for expressing recombinant Pan paniscus TAS2R20?

Obtaining functional recombinant TAS2R20 requires careful optimization of expression systems and conditions.

Methodological approach:

  • Expression system selection (bacterial systems like E. coli are commonly used for TAS2R proteins)

  • Codon optimization for the selected expression system

  • Addition of fusion tags to improve solubility and facilitate purification

  • Optimization of induction conditions (temperature, inducer concentration, time)

  • Use of detergents or lipid environments to maintain proper folding of this membrane protein

  • Storage in appropriate buffer conditions, typically containing glycerol at -20°C or -80°C for extended storage

How can researchers verify the functionality of recombinant TAS2R20?

Confirming that recombinant TAS2R20 is properly folded and functional is essential before conducting binding or activity studies.

Methodological approach:

  • Circular dichroism spectroscopy to assess secondary structure

  • Fluorescence-based ligand binding assays

  • Calcium mobilization assays in heterologous expression systems

  • GTPγS binding assays to measure G protein coupling

  • Comparative analysis with known functional TAS2R proteins

What methodologies are most effective for identifying TAS2R20 ligands?

Identifying compounds that activate TAS2R20 is crucial for understanding its biological role.

Methodological approach:

  • High-throughput screening of bitter compound libraries

  • Calcium imaging or FLIPR-based functional assays

  • Structure-activity relationship studies with related compounds

  • In silico docking studies to predict binding interactions

  • Testing of ecologically relevant compounds based on bonobo diet and environment

How do genetic variations in TAS2R20 affect receptor function?

Understanding the functional consequences of genetic variations in TAS2R20 can provide insights into evolutionary adaptations and individual differences in bitter taste perception.

Methodological approach:

  • Identification of natural variants through population genomics

  • Site-directed mutagenesis to introduce specific variations

  • Functional characterization of variants using calcium imaging or other signaling assays

  • Correlation of genetic variations with dietary preferences or avoidance behaviors

  • Homology modeling to predict structural impacts of variations

What approaches can be used to investigate TAS2R20 signaling pathways?

Understanding the downstream signaling of TAS2R20 is important for elucidating its physiological functions.

Methodological approach:

  • Co-immunoprecipitation to identify interacting proteins

  • BRET/FRET assays to study receptor-effector interactions

  • Phosphorylation studies to identify regulatory mechanisms

  • RNA-seq analysis to identify transcriptional responses to receptor activation

  • CRISPR/Cas9-mediated knockout to study loss-of-function effects

How can researchers study potential extra-oral functions of TAS2R20?

TAS2R count is proportional to receptors expressed in extra-oral tissues, suggesting functions beyond taste perception .

Methodological approach:

  • Tissue-specific expression analysis

  • Functional assays in non-gustatory cell types expressing TAS2R20

  • Testing responses to tissue-specific chemicals or endogenous compounds

  • Knockout studies in cell culture models

  • Analysis of receptor distribution in tissues using immunohistochemistry or in situ hybridization

What are the best approaches for comparative analysis of TAS2R20 function across primates?

Comparing TAS2R20 function across different primate species can provide insights into dietary adaptations and evolutionary selection pressures.

Methodological approach:

  • Parallel expression and functional characterization of TAS2R20 from multiple species

  • Correlation of functional differences with dietary specializations

  • Analysis of selection signatures in TAS2R20 sequences

  • Testing species-specific compounds relevant to natural diets

  • Computational modeling of receptor-ligand interactions across species

How can computational approaches enhance TAS2R20 research?

Computational methods can complement experimental approaches in understanding TAS2R20 structure and function.

Methodological approach:

  • Homology modeling based on related GPCR structures

  • Molecular dynamics simulations to study receptor dynamics

  • Virtual screening to identify potential ligands

  • Machine learning approaches to predict ligand binding

  • Evolutionary analysis to identify functionally important residues

What are the challenges in developing specific antibodies against Pan paniscus TAS2R20?

Developing specific antibodies for TAS2R20 is challenging due to the high sequence similarity with other TAS2R family members.

Methodological approach:

  • Identification of unique epitopes in TAS2R20 for antibody development

  • Generation of monoclonal antibodies targeting specific domains

  • Validation of antibody specificity using knockout controls

  • Cross-reactivity testing against other TAS2R family members

  • Use of epitope tags in recombinant proteins as alternatives

How can researchers develop reliable assays for TAS2R20 detection in biological samples?

Developing sensitive and specific assays for TAS2R20 detection is essential for studying its expression and regulation.

Methodological approach:

  • Development of sandwich ELISA assays similar to those available for other TAS2R receptors

  • Optimization of sample preparation protocols for different tissue types

  • Validation of assay specificity using recombinant standards

  • Determination of detection limits and dynamic range

  • Cross-validation with orthogonal detection methods

What strategies can be employed to study TAS2R20 evolution in the context of primate dietary adaptations?

Understanding TAS2R20 evolution provides insights into dietary adaptations and selective pressures.

Methodological approach:

  • Phylogenetic analysis of TAS2R20 sequences across primates

  • Tests for positive selection using dN/dS ratios

  • Correlation of sequence variations with dietary differences

  • Ancestral sequence reconstruction

  • Functional characterization of ancestral and extant receptors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.