TAS2R30, also termed TAS2R47 or T2R47, belongs to the TAS2R family of G protein-coupled receptors (GPCRs) responsible for detecting bitter compounds . Key features include:
Protein structure: 310 amino acids with seven transmembrane domains (TMs)
Functional role: Enables bitter taste receptor activity and participates in chemical stimulus detection
A partial sequence of its N-terminal and transmembrane regions is shown below:
| Region | Sequence (positions 1–30) |
|---|---|
| N-term/TM1 | MITFLPIIFSILIVVIFVGNGFIALVNSIEWVKRQK |
Recombinant TAS2R30 enables:
In vitro assays: Calcium flux or GTPγS binding assays to screen bitter compounds .
Structure-function studies: Mapping ligand-binding regions using site-directed mutagenesis .
Comparative genomics: Investigating primate-specific bitter taste adaptations .
Current challenges include:
Unknown endogenous or synthetic agonists.
Limited cross-species functional comparisons due to sparse Pan paniscus-specific data .
Future work could leverage cryo-EM or directed evolution to characterize ligand interactions and signaling pathways.
TAS2R30 (also known as TAS2R47 or T2R47) is a G protein-coupled receptor expressed in Pan paniscus (bonobo) that belongs to the Class T2 (Taste 2) family of sensory receptors . It functions as a bitter taste receptor, allowing bonobos to detect potentially harmful bitter compounds in their environment. As a member of the T2R family, this receptor plays a crucial role in dietary selection and toxin avoidance behaviors.
The receptor is characterized by significant sequence homology to other T2R family members, with a specific structural organization typical of GPCRs: seven transmembrane domains (TM1-TM7), three extracellular loops (ECL1-ECL3), three intracellular loops (ICL1-ICL3), an N-terminal domain, and a C-terminal domain . When a bitter ligand binds to the receptor, it triggers a signal transduction cascade that ultimately results in the perception of bitterness.
Pan paniscus TAS2R30 follows the canonical GPCR architecture with several distinguishing features:
Transmembrane topology: The receptor contains seven transmembrane (TM) domains organized in an alpha-helical bundle structure, with amino acids 11-30 forming TM1, 51-70 forming TM2, 81-110 forming TM3, 126-150 forming TM4, 176-210 forming TM5, 226-250 forming TM6, and 261-280 forming TM7 .
Loop regions: The receptor features three extracellular loops (ECL1: 71-80, ECL2: 151-175, ECL3: 251-260) and three intracellular loops (ICL1: 41-50, ICL2: 111-125, ICL3: 211-225), which contribute to ligand binding specificity and G protein coupling .
Terminal domains: TAS2R30 has relatively short N-terminal (residues 1-10) and C-terminal domains (residues 281-319), with the C-terminus containing a potential helix 8 structure (281-300) common in GPCRs .
Unlike many Class A GPCRs, T2R receptors including TAS2R30 generally lack the conserved "DRY" motif in TM3 and the "NPxxY" motif in TM7 that are characteristic of Class A GPCRs, reflecting their divergent evolutionary path within the GPCR superfamily.
For successful recombinant expression of Pan paniscus TAS2R30, researchers should consider the following expression systems:
HEK293T cells: Offer native-like post-translational modifications and membrane composition
CHO cells: Provide stable expression with proper folding and trafficking
Gene synthesis with codon optimization for the selected expression system
Incorporation of N-terminal signal sequences (e.g., from rhodopsin) to improve membrane targeting
C-terminal epitope tags (FLAG, myc, or His-tag) for detection and purification
Use of inducible expression systems (tetracycline-controlled) to manage potential cytotoxicity
Consideration of fusion partners (e.g., T4-lysozyme) for structural studies
When designing expression constructs, researchers should note that Pan paniscus TAS2R30 has a complete coding sequence of 319 amino acids and may require optimization of the N-terminal domain for efficient cell surface expression.
The evolutionary relationship between Pan paniscus TAS2R30 and human TAS2R genes reveals important insights into primate taste perception adaptation:
Sequence conservation: Pan paniscus TAS2R30 shows high sequence homology with human TAS2R genes, reflecting their recent evolutionary divergence (approximately 5-7 million years) .
Evolutionary patterns: Unlike olfactory receptors, which show significant human-specific pseudogenization, T2R genes including TAS2R30 do not demonstrate a human-specific functional gene loss pattern . This conservation suggests ongoing selective pressure for maintaining bitter taste perception in both species.
Sequence alterations: Comparison between human and Pan paniscus T2R genes shows differences ranging from large sequence alterations to nonsynonymous and synonymous single nucleotide changes . These variations likely reflect species-specific dietary adaptations.
Functional implications: The differences identified between human and bonobo TAS2R30 suggest species-specific sensitivities to bitter compounds, potentially correlating with dietary preferences and food selection behaviors in their respective natural habitats.
The evolutionary analysis of TAS2R30 supports the hypothesis that T2R receptor diversification plays a crucial role in dietary adaptation and personalized food preferences in primates .
Researchers working with recombinant Pan paniscus TAS2R30 encounter several technical challenges:
Low surface expression levels
Protein misfolding
Aggregation during solubilization
Variability in receptor coupling efficiency
Background signaling in heterologous systems
Limited availability of known ligands
Improving expression:
Use of rhodopsin signal sequences and chaperone co-expression
Incorporate maltose-binding protein as an N-terminal fusion partner
Develop stable cell lines with optimized culture conditions
Enhancing functional assays:
Employ chimeric G proteins (e.g., Gα16-gust44) to improve coupling
Develop bioluminescence resonance energy transfer (BRET) assays for direct measurement of receptor activation
Implement high-throughput calcium imaging with automated analysis
Solubilization strategies:
Use of mild detergents (DDM, LMNG) supplemented with cholesterol hemisuccinate
Application of nanodiscs or styrene maleic acid lipid particles (SMALPs) to maintain native-like lipid environment
For comprehensive functional characterization of recombinant Pan paniscus TAS2R30, researchers should employ a multi-faceted approach:
Implement Fluo-4 AM loading of transfected cells
Use automated fluorescent plate readers for high-throughput screening
Develop dose-response curves with EC50 determination for identified ligands
Employ fluorescently-tagged receptors with confocal microscopy
Quantify receptor trafficking using surface biotinylation
Assess interaction with β-arrestins using BRET or co-immunoprecipitation
Determine G protein specificity using siRNA knockdown approaches
Utilize FRET-based sensors to measure G protein activation kinetics
Assess downstream signaling pathway activation (PLCβ, IP3, DAG)
Develop radiolabeled or fluorescent bitter compounds for direct binding assays
Implement molecular docking with homology models
Utilize site-directed mutagenesis to identify critical binding residues
Cross-species comparison with human and chimpanzee orthologues
Assess responses to a diverse panel of bitter compounds
Correlate functional differences with sequence variations
These methodologies should be applied systematically with appropriate controls to ensure reliable characterization of the receptor's pharmacological properties.
Site-directed mutagenesis represents a powerful approach for investigating the structural determinants of ligand binding in Pan paniscus TAS2R30:
Transmembrane domain focus:
Extracellular loop investigation:
Mutate residues in ECL2 (151-175), which often contributes to ligand entry and specificity
Assess the role of conserved cysteine residues that may form stabilizing disulfide bonds
Evolutionary guidance:
Target residues that differ between Pan paniscus and human TAS2R30
Focus on positions showing evidence of positive selection across primate species
Alanine scanning: Systematic replacement with alanine to identify essential residues
Conservative substitutions: Replace with physicochemically similar amino acids
Radical substitutions: Alter charge, polarity, or size to test tolerance
Reciprocal mutations: Swap residues between human and bonobo receptors
Calcium flux assays to determine changes in EC50 and Emax values
Surface expression analysis to confirm proper folding and trafficking
Molecular dynamics simulations to interpret experimental findings
This systematic mutagenesis approach allows for the development of a comprehensive map of the ligand-binding pocket and species-specific determinants of bitter compound recognition.
Advanced computational methods offer powerful tools for predicting potential bitter ligands for Pan paniscus TAS2R30:
Template selection from structurally characterized GPCRs
Sequence alignment optimization focusing on conserved GPCR motifs
Model refinement through energy minimization and molecular dynamics
Validation using known ligand interactions and mutagenesis data
Structure-based screening:
Molecular docking of compound libraries to the receptor binding site
Ensemble docking to account for receptor flexibility
MM-GBSA (Molecular Mechanics-Generalized Born Surface Area) rescoring of docking poses
Ligand-based approaches:
Pharmacophore modeling based on known bitter compounds
Quantitative structure-activity relationship (QSAR) analysis
Machine learning classification of potential bitter ligands
Assessment of binding pose stability over nanosecond timescales
Identification of key receptor-ligand interaction networks
Calculation of binding free energies using enhanced sampling methods
Selection of top computational hits for experimental testing
Iterative refinement of models based on experimental feedback
Development of focused compound libraries based on confirmed hits
These computational approaches can substantially accelerate the discovery of novel ligands for Pan paniscus TAS2R30 and provide structural insights that would be difficult to obtain experimentally.
The evolutionary trajectory of TAS2R30 in Pan paniscus reveals important adaptive patterns:
Sequence divergence patterns: TAS2R30 shows evidence of ongoing evolutionary diversification across primate species, with variations ranging from single nucleotide changes to larger sequence alterations .
Selection pressure assessment: Unlike olfactory receptors that show significant human-specific pseudogenization, T2R genes including TAS2R30 maintain functionality across Pan paniscus, Pan troglodytes, and humans, suggesting continued evolutionary pressure for bitter taste perception .
Functional diversification: The sequence differences between species likely reflect adaptations to specific dietary niches and local plant secondary metabolites encountered in different habitats.
Dietary adaptation: The evolutionary pattern of TAS2R30 supports its role in dietary adaptation, allowing species to develop sensitivity to bitter compounds relevant to their specific food sources .
Toxin detection: Maintenance of functional TAS2R30 across primates emphasizes the continued importance of detecting potentially harmful plant compounds.
Species-specific taste perception: The variations identified between human and bonobo TAS2R30 likely contribute to differences in bitter taste perception, potentially affecting food preferences and selection behaviors.
The evolutionary analysis supports the hypothesis that TAS2R receptors play a critical role in dietary adaptation and represent an example of ongoing molecular evolution in response to environmental pressures .
Recent methodological innovations have significantly enhanced calcium imaging approaches for studying TAS2R30 function:
Genetically-encoded calcium indicators (GECIs):
GCaMP6f for faster kinetics and improved signal-to-noise ratio
R-GECO1 for multicolor imaging applications
Targeted indicators with membrane localization signals for better detection
Ratiometric dyes (Fura-2) for absolute calcium concentration measurements
Automated fluorescence plate readers with integrated liquid handling
Microfluidic systems for precise temporal control of ligand application
High-content imaging systems allowing single-cell resolution in 384-well format
Automated image segmentation for single-cell response tracking
Machine learning algorithms for response classification
Time-series analysis for complex response pattern identification
Simultaneous electrophysiology and calcium imaging
Correlation with receptor trafficking using pH-sensitive fluorescent tags
Optogenetic control of cellular components combined with calcium readouts
Use of stable cell lines expressing defined receptor levels
Implementation of internal controls for normalization
Careful selection of calcium buffer conditions to match physiological relevance
These advanced calcium imaging approaches provide unprecedented sensitivity and throughput for functional characterization of Pan paniscus TAS2R30 responses to potential bitter ligands.
Despite the challenges associated with membrane protein structural studies, several approaches can be employed to characterize Pan paniscus TAS2R30:
Thermostabilizing mutations to enhance receptor stability
Lipidic cubic phase crystallization
T4-lysozyme or BRIL fusion constructs to provide crystal contacts
Antibody-mediated crystallization using conformationally selective nanobodies
Single-particle analysis of detergent-solubilized receptor
Studies in nanodiscs to maintain native lipid environment
Use of Fab fragments to increase particle size and provide fiducial markers
Implementation of advanced data processing algorithms for sub-3Å resolution
Solution NMR of selectively labeled receptor domains
Solid-state NMR for full-length receptor characterization
Ligand-observed NMR for binding site mapping
19F-NMR for dynamic studies using strategic fluorine labeling
Conformational dynamics assessment
Ligand-induced protection mapping
Comparison between species orthologues to identify functional differences
Identification of intramolecular contacts
Verification of homology model predictions
Investigation of receptor-G protein interfaces
The integration of these structural approaches, while technically demanding, would provide unprecedented insights into the molecular architecture of Pan paniscus TAS2R30 and its interaction with bitter ligands.
Conducting research with Pan paniscus samples requires adherence to strict ethical guidelines:
Recognition of bonobos as an endangered species requiring special protection
Commitment to non-invasive or minimally invasive sample collection
Ensuring research benefits conservation efforts when possible
Respecting international treaties including CITES (Convention on International Trade in Endangered Species)
Non-invasive collection:
Utilizing existing biobanks and repositories
Coordination with zoological institutions during routine health examinations
Salvage samples from naturally deceased individuals
Alternatives to direct sampling:
Use of existing cell lines derived from Pan paniscus
Development of induced pluripotent stem cells from minimally invasive samples
Implementation of recombinant DNA technology to avoid new sampling
Obtain all required permits from national and international authorities
Secure approval from appropriate institutional animal care committees
Document clear material transfer agreements
Implement data sharing plans to maximize scientific value from limited samples
Employ methods requiring minimal sample quantities
Develop immortalized cell lines when possible
Share resources with other qualified researchers
Return research results to conservation databases
Responsible research with Pan paniscus samples demonstrates respect for this endangered species while advancing our understanding of taste receptor biology in our closest living relatives.