Recombinant Pan paniscus Taste receptor type 2 member 30 (TAS2R30)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

TAS2R30, also termed TAS2R47 or T2R47, belongs to the TAS2R family of G protein-coupled receptors (GPCRs) responsible for detecting bitter compounds . Key features include:

  • Gene locus: Chromosome 12p13.2 in Pan paniscus

  • Protein structure: 310 amino acids with seven transmembrane domains (TMs)

  • Functional role: Enables bitter taste receptor activity and participates in chemical stimulus detection

A partial sequence of its N-terminal and transmembrane regions is shown below:

RegionSequence (positions 1–30)
N-term/TM1MITFLPIIFSILIVVIFVGNGFIALVNSIEWVKRQK

Research Applications

Recombinant TAS2R30 enables:

  • In vitro assays: Calcium flux or GTPγS binding assays to screen bitter compounds .

  • Structure-function studies: Mapping ligand-binding regions using site-directed mutagenesis .

  • Comparative genomics: Investigating primate-specific bitter taste adaptations .

Limitations and Future Directions

Current challenges include:

  • Lack of resolved 3D structures for TAS2R30 .

  • Unknown endogenous or synthetic agonists.

  • Limited cross-species functional comparisons due to sparse Pan paniscus-specific data .

Future work could leverage cryo-EM or directed evolution to characterize ligand interactions and signaling pathways.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
TAS2R30; TAS2R47; Taste receptor type 2 member 30; Taste receptor type 2 member 47; T2R47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MITFLPIIFSILIVVIFVVGNFANGFIALVNSIEWVKRQKISFVDQILTALAVSRVGLLW VLLLHWYATQLNPAFYSVEVRITVYNVWAVTNHFSSWLATSLSMFYLLKIANFSNLIFLR IKRRVKSVVLVILLGPLLFLVCHLFVINMDETIWTKEYEGNMTWKIKLKSAMYHSNMTLT ILANFVPLTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAI YFLSMIISVCNLGRLQKQPVFMFCQAIIFSYPSTHPFILILGNKKLKQIFLSVLWHVRYW VKDRSLRLHRFTRAALCKG
Uniprot No.

Target Background

Function
This receptor is thought to play a role in the perception of bitterness and is linked to gustducin. It may also be involved in sensing the chemical composition of gastrointestinal contents. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R30 in Pan paniscus and what is its primary function in bitter taste perception?

TAS2R30 (also known as TAS2R47 or T2R47) is a G protein-coupled receptor expressed in Pan paniscus (bonobo) that belongs to the Class T2 (Taste 2) family of sensory receptors . It functions as a bitter taste receptor, allowing bonobos to detect potentially harmful bitter compounds in their environment. As a member of the T2R family, this receptor plays a crucial role in dietary selection and toxin avoidance behaviors.

The receptor is characterized by significant sequence homology to other T2R family members, with a specific structural organization typical of GPCRs: seven transmembrane domains (TM1-TM7), three extracellular loops (ECL1-ECL3), three intracellular loops (ICL1-ICL3), an N-terminal domain, and a C-terminal domain . When a bitter ligand binds to the receptor, it triggers a signal transduction cascade that ultimately results in the perception of bitterness.

How does the structural organization of Pan paniscus TAS2R30 compare to other G protein-coupled receptors?

Pan paniscus TAS2R30 follows the canonical GPCR architecture with several distinguishing features:

  • Transmembrane topology: The receptor contains seven transmembrane (TM) domains organized in an alpha-helical bundle structure, with amino acids 11-30 forming TM1, 51-70 forming TM2, 81-110 forming TM3, 126-150 forming TM4, 176-210 forming TM5, 226-250 forming TM6, and 261-280 forming TM7 .

  • Loop regions: The receptor features three extracellular loops (ECL1: 71-80, ECL2: 151-175, ECL3: 251-260) and three intracellular loops (ICL1: 41-50, ICL2: 111-125, ICL3: 211-225), which contribute to ligand binding specificity and G protein coupling .

  • Terminal domains: TAS2R30 has relatively short N-terminal (residues 1-10) and C-terminal domains (residues 281-319), with the C-terminus containing a potential helix 8 structure (281-300) common in GPCRs .

Unlike many Class A GPCRs, T2R receptors including TAS2R30 generally lack the conserved "DRY" motif in TM3 and the "NPxxY" motif in TM7 that are characteristic of Class A GPCRs, reflecting their divergent evolutionary path within the GPCR superfamily.

What are the recommended expression systems for recombinant production of Pan paniscus TAS2R30?

For successful recombinant expression of Pan paniscus TAS2R30, researchers should consider the following expression systems:

Mammalian cell lines:

  • HEK293T cells: Offer native-like post-translational modifications and membrane composition

  • CHO cells: Provide stable expression with proper folding and trafficking

Methodology for optimal expression:

  • Gene synthesis with codon optimization for the selected expression system

  • Incorporation of N-terminal signal sequences (e.g., from rhodopsin) to improve membrane targeting

  • C-terminal epitope tags (FLAG, myc, or His-tag) for detection and purification

  • Use of inducible expression systems (tetracycline-controlled) to manage potential cytotoxicity

  • Consideration of fusion partners (e.g., T4-lysozyme) for structural studies

When designing expression constructs, researchers should note that Pan paniscus TAS2R30 has a complete coding sequence of 319 amino acids and may require optimization of the N-terminal domain for efficient cell surface expression.

How does Pan paniscus TAS2R30 compare evolutionarily to human TAS2R genes?

The evolutionary relationship between Pan paniscus TAS2R30 and human TAS2R genes reveals important insights into primate taste perception adaptation:

  • Sequence conservation: Pan paniscus TAS2R30 shows high sequence homology with human TAS2R genes, reflecting their recent evolutionary divergence (approximately 5-7 million years) .

  • Evolutionary patterns: Unlike olfactory receptors, which show significant human-specific pseudogenization, T2R genes including TAS2R30 do not demonstrate a human-specific functional gene loss pattern . This conservation suggests ongoing selective pressure for maintaining bitter taste perception in both species.

  • Sequence alterations: Comparison between human and Pan paniscus T2R genes shows differences ranging from large sequence alterations to nonsynonymous and synonymous single nucleotide changes . These variations likely reflect species-specific dietary adaptations.

  • Functional implications: The differences identified between human and bonobo TAS2R30 suggest species-specific sensitivities to bitter compounds, potentially correlating with dietary preferences and food selection behaviors in their respective natural habitats.

The evolutionary analysis of TAS2R30 supports the hypothesis that T2R receptor diversification plays a crucial role in dietary adaptation and personalized food preferences in primates .

What are the common challenges in working with recombinant TAS2R30 and how can they be addressed?

Researchers working with recombinant Pan paniscus TAS2R30 encounter several technical challenges:

Expression challenges:

  • Low surface expression levels

  • Protein misfolding

  • Aggregation during solubilization

Functional assay limitations:

  • Variability in receptor coupling efficiency

  • Background signaling in heterologous systems

  • Limited availability of known ligands

Methodological solutions:

  • Improving expression:

    • Use of rhodopsin signal sequences and chaperone co-expression

    • Incorporate maltose-binding protein as an N-terminal fusion partner

    • Develop stable cell lines with optimized culture conditions

  • Enhancing functional assays:

    • Employ chimeric G proteins (e.g., Gα16-gust44) to improve coupling

    • Develop bioluminescence resonance energy transfer (BRET) assays for direct measurement of receptor activation

    • Implement high-throughput calcium imaging with automated analysis

  • Solubilization strategies:

    • Use of mild detergents (DDM, LMNG) supplemented with cholesterol hemisuccinate

    • Application of nanodiscs or styrene maleic acid lipid particles (SMALPs) to maintain native-like lipid environment

What methodologies are most effective for functional characterization of recombinant Pan paniscus TAS2R30?

For comprehensive functional characterization of recombinant Pan paniscus TAS2R30, researchers should employ a multi-faceted approach:

Calcium mobilization assays:

  • Implement Fluo-4 AM loading of transfected cells

  • Use automated fluorescent plate readers for high-throughput screening

  • Develop dose-response curves with EC50 determination for identified ligands

Receptor internalization studies:

  • Employ fluorescently-tagged receptors with confocal microscopy

  • Quantify receptor trafficking using surface biotinylation

  • Assess interaction with β-arrestins using BRET or co-immunoprecipitation

G protein coupling analysis:

  • Determine G protein specificity using siRNA knockdown approaches

  • Utilize FRET-based sensors to measure G protein activation kinetics

  • Assess downstream signaling pathway activation (PLCβ, IP3, DAG)

Ligand binding studies:

  • Develop radiolabeled or fluorescent bitter compounds for direct binding assays

  • Implement molecular docking with homology models

  • Utilize site-directed mutagenesis to identify critical binding residues

Comparative analysis:

  • Cross-species comparison with human and chimpanzee orthologues

  • Assess responses to a diverse panel of bitter compounds

  • Correlate functional differences with sequence variations

These methodologies should be applied systematically with appropriate controls to ensure reliable characterization of the receptor's pharmacological properties.

How can site-directed mutagenesis be strategically applied to study ligand binding in Pan paniscus TAS2R30?

Site-directed mutagenesis represents a powerful approach for investigating the structural determinants of ligand binding in Pan paniscus TAS2R30:

Strategic approach to mutagenesis:

  • Transmembrane domain focus:

    • Target residues in TM3, TM5, and TM6, which typically form the ligand-binding pocket in GPCRs

    • Specifically examine residues at positions 86-94 in TM3, 187-195 in TM5, and 230-239 in TM6

  • Extracellular loop investigation:

    • Mutate residues in ECL2 (151-175), which often contributes to ligand entry and specificity

    • Assess the role of conserved cysteine residues that may form stabilizing disulfide bonds

  • Evolutionary guidance:

    • Target residues that differ between Pan paniscus and human TAS2R30

    • Focus on positions showing evidence of positive selection across primate species

Mutation strategies:

  • Alanine scanning: Systematic replacement with alanine to identify essential residues

  • Conservative substitutions: Replace with physicochemically similar amino acids

  • Radical substitutions: Alter charge, polarity, or size to test tolerance

  • Reciprocal mutations: Swap residues between human and bonobo receptors

Functional readout methods:

  • Calcium flux assays to determine changes in EC50 and Emax values

  • Surface expression analysis to confirm proper folding and trafficking

  • Molecular dynamics simulations to interpret experimental findings

This systematic mutagenesis approach allows for the development of a comprehensive map of the ligand-binding pocket and species-specific determinants of bitter compound recognition.

What computational approaches can predict bitter ligands for Pan paniscus TAS2R30 and guide experimental design?

Advanced computational methods offer powerful tools for predicting potential bitter ligands for Pan paniscus TAS2R30:

Homology modeling approaches:

  • Template selection from structurally characterized GPCRs

  • Sequence alignment optimization focusing on conserved GPCR motifs

  • Model refinement through energy minimization and molecular dynamics

  • Validation using known ligand interactions and mutagenesis data

Virtual screening strategies:

  • Structure-based screening:

    • Molecular docking of compound libraries to the receptor binding site

    • Ensemble docking to account for receptor flexibility

    • MM-GBSA (Molecular Mechanics-Generalized Born Surface Area) rescoring of docking poses

  • Ligand-based approaches:

    • Pharmacophore modeling based on known bitter compounds

    • Quantitative structure-activity relationship (QSAR) analysis

    • Machine learning classification of potential bitter ligands

Molecular dynamics simulations:

  • Assessment of binding pose stability over nanosecond timescales

  • Identification of key receptor-ligand interaction networks

  • Calculation of binding free energies using enhanced sampling methods

Integration with experimental validation:

  • Selection of top computational hits for experimental testing

  • Iterative refinement of models based on experimental feedback

  • Development of focused compound libraries based on confirmed hits

These computational approaches can substantially accelerate the discovery of novel ligands for Pan paniscus TAS2R30 and provide structural insights that would be difficult to obtain experimentally.

How does evolutionary pressure affect TAS2R30 in Pan paniscus compared to other primates?

The evolutionary trajectory of TAS2R30 in Pan paniscus reveals important adaptive patterns:

Comparative evolutionary analysis:

  • Sequence divergence patterns: TAS2R30 shows evidence of ongoing evolutionary diversification across primate species, with variations ranging from single nucleotide changes to larger sequence alterations .

  • Selection pressure assessment: Unlike olfactory receptors that show significant human-specific pseudogenization, T2R genes including TAS2R30 maintain functionality across Pan paniscus, Pan troglodytes, and humans, suggesting continued evolutionary pressure for bitter taste perception .

  • Functional diversification: The sequence differences between species likely reflect adaptations to specific dietary niches and local plant secondary metabolites encountered in different habitats.

Evolutionary implications:

  • Dietary adaptation: The evolutionary pattern of TAS2R30 supports its role in dietary adaptation, allowing species to develop sensitivity to bitter compounds relevant to their specific food sources .

  • Toxin detection: Maintenance of functional TAS2R30 across primates emphasizes the continued importance of detecting potentially harmful plant compounds.

  • Species-specific taste perception: The variations identified between human and bonobo TAS2R30 likely contribute to differences in bitter taste perception, potentially affecting food preferences and selection behaviors.

The evolutionary analysis supports the hypothesis that TAS2R receptors play a critical role in dietary adaptation and represent an example of ongoing molecular evolution in response to environmental pressures .

What are the latest advancements in calcium imaging techniques for studying TAS2R30 functional responses?

Recent methodological innovations have significantly enhanced calcium imaging approaches for studying TAS2R30 function:

Advanced calcium indicators:

  • Genetically-encoded calcium indicators (GECIs):

    • GCaMP6f for faster kinetics and improved signal-to-noise ratio

    • R-GECO1 for multicolor imaging applications

    • Targeted indicators with membrane localization signals for better detection

  • Ratiometric dyes (Fura-2) for absolute calcium concentration measurements

High-throughput platforms:

  • Automated fluorescence plate readers with integrated liquid handling

  • Microfluidic systems for precise temporal control of ligand application

  • High-content imaging systems allowing single-cell resolution in 384-well format

Analysis innovations:

  • Automated image segmentation for single-cell response tracking

  • Machine learning algorithms for response classification

  • Time-series analysis for complex response pattern identification

Integration with other techniques:

  • Simultaneous electrophysiology and calcium imaging

  • Correlation with receptor trafficking using pH-sensitive fluorescent tags

  • Optogenetic control of cellular components combined with calcium readouts

Experimental design considerations:

  • Use of stable cell lines expressing defined receptor levels

  • Implementation of internal controls for normalization

  • Careful selection of calcium buffer conditions to match physiological relevance

These advanced calcium imaging approaches provide unprecedented sensitivity and throughput for functional characterization of Pan paniscus TAS2R30 responses to potential bitter ligands.

How can structural biology techniques be applied to characterize the Pan paniscus TAS2R30 receptor?

Despite the challenges associated with membrane protein structural studies, several approaches can be employed to characterize Pan paniscus TAS2R30:

X-ray crystallography strategies:

  • Thermostabilizing mutations to enhance receptor stability

  • Lipidic cubic phase crystallization

  • T4-lysozyme or BRIL fusion constructs to provide crystal contacts

  • Antibody-mediated crystallization using conformationally selective nanobodies

Cryo-electron microscopy approaches:

  • Single-particle analysis of detergent-solubilized receptor

  • Studies in nanodiscs to maintain native lipid environment

  • Use of Fab fragments to increase particle size and provide fiducial markers

  • Implementation of advanced data processing algorithms for sub-3Å resolution

NMR spectroscopy applications:

  • Solution NMR of selectively labeled receptor domains

  • Solid-state NMR for full-length receptor characterization

  • Ligand-observed NMR for binding site mapping

  • 19F-NMR for dynamic studies using strategic fluorine labeling

Hydrogen-deuterium exchange mass spectrometry:

  • Conformational dynamics assessment

  • Ligand-induced protection mapping

  • Comparison between species orthologues to identify functional differences

Cross-linking mass spectrometry:

  • Identification of intramolecular contacts

  • Verification of homology model predictions

  • Investigation of receptor-G protein interfaces

The integration of these structural approaches, while technically demanding, would provide unprecedented insights into the molecular architecture of Pan paniscus TAS2R30 and its interaction with bitter ligands.

What are the ethical considerations and best practices for obtaining Pan paniscus biological samples for TAS2R30 research?

Conducting research with Pan paniscus samples requires adherence to strict ethical guidelines:

Ethical framework:

  • Recognition of bonobos as an endangered species requiring special protection

  • Commitment to non-invasive or minimally invasive sample collection

  • Ensuring research benefits conservation efforts when possible

  • Respecting international treaties including CITES (Convention on International Trade in Endangered Species)

Sample acquisition approaches:

  • Non-invasive collection:

    • Utilizing existing biobanks and repositories

    • Coordination with zoological institutions during routine health examinations

    • Salvage samples from naturally deceased individuals

  • Alternatives to direct sampling:

    • Use of existing cell lines derived from Pan paniscus

    • Development of induced pluripotent stem cells from minimally invasive samples

    • Implementation of recombinant DNA technology to avoid new sampling

Documentation and permissions:

  • Obtain all required permits from national and international authorities

  • Secure approval from appropriate institutional animal care committees

  • Document clear material transfer agreements

  • Implement data sharing plans to maximize scientific value from limited samples

Best practices for sample utilization:

  • Employ methods requiring minimal sample quantities

  • Develop immortalized cell lines when possible

  • Share resources with other qualified researchers

  • Return research results to conservation databases

Responsible research with Pan paniscus samples demonstrates respect for this endangered species while advancing our understanding of taste receptor biology in our closest living relatives.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.