Recombinant Pan paniscus Taste receptor type 2 member 38 (TAS2R38)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Pan paniscus Taste Receptor Type 2 Member 38 (TAS2R38) is a genetically engineered version of the bitter taste receptor TAS2R38 derived from the pygmy chimpanzee (Pan paniscus). This receptor belongs to the T2R family of G protein-coupled receptors (GPCRs), which mediate bitter taste perception and participate in extraoral physiological processes, including innate immune responses . Recombinant production enables large-scale synthesis for functional, structural, and pharmacological studies.

Sequence and Domains

The Pan paniscus TAS2R38 receptor shares a conserved seven-transmembrane (7TM) helical structure typical of GPCRs. Key residues involved in ligand binding and signal transduction are highlighted below :

DomainResidues (Positions)Functional Role
N-terminalMLTLTRIHTV (1–10)Receptor stability
TransmembraneSYEVRSFLFI (TM1), LIRFSHTFLI (TM4)Ligand binding pocket formation
ECL2CFFSRPHFTV (160–170)Critical for agonist interaction (e.g., PTC)
C-terminalVRADHKADS (320–330)G-protein coupling

The full amino acid sequence (333 residues) includes three common polymorphic sites (Ala49Pro, Ala262Val, Ile296Val), analogous to human haplotypes (PAV/AVI) .

2.3D Structure Predictions

Computational models predict that the Pan paniscus TAS2R38 adopts a ligand-binding pocket stabilized by hydrogen bonds between transmembrane helices (e.g., TM3-TM6 interactions) . Mutations at positions 49, 262, or 296 disrupt these interactions, altering receptor activation .

Production and Purification

Recombinant TAS2R38 is synthesized using heterologous expression systems. Key parameters include :

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (verified via SDS-PAGE)
ApplicationsELISA, calcium imaging, ligand-binding assays
Commercial AvailabilityAntibodies (HRP/Biotin-conjugated), partial/full-length constructs

Ligand Specificity

The receptor binds bitter compounds, including:

LigandSourceResponse
Phenylthiocarbamide (PTC)SyntheticStrong activation in PAV haplotype
6-n-Propylthiouracil (PROP)PharmaceuticalsDose-dependent calcium signaling
LimoninCitrus fruitsModerate agonist activity
ChlorpheniramineAntihistaminesBitter off-target activation

Immune Modulation

TAS2R38 in Pan paniscus likely mirrors human roles in sinonasal immunity:

  • Pathogen Defense: Bitter agonists (e.g., bacterial acyl-homoserine lactones) trigger nitric oxide (NO) production, enhancing mucociliary clearance .

  • Haplotype Effects: PAV/PAV genotypes show stronger NO responses than AVI/AVI .

Mechanistic Studies

  • Ligand-Receptor Dynamics: Molecular docking simulations (e.g., DarwinDock) map interactions between PROP/PTC and residues Asn103, Phe197, Trp201 .

  • Ciliary Signaling: Knockout models assess TAS2R38’s role in cilia-dependent immune responses .

Clinical Relevance

  • Chronic Rhinosinusitis (CRS): AVI/AVI haplotypes correlate with severe CRS and Pseudomonas aeruginosa infections .

  • Longevity Studies: PAV/PAV genotypes associate with exceptional lifespan in humans, suggesting conserved pathways in primates .

Comparative Analysis

FeaturePan paniscus TAS2R38Human TAS2R38
Ligand ProfileBroad (23+ ligands) Similar, with PTC/PROP focus
Haplotype PrevalencePAV (~50%), AVI (~43%) PAV (20–50%), AVI (30–40%)
Immune RolePathogen sensing Identical mechanisms

Challenges and Future Directions

  • Structural Resolution: No experimental 3D structures exist; cryo-EM studies are needed .

  • Primate-Specific Roles: Functional divergence from human orthologs remains unexplored.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R38; Taste receptor type 2 member 38; T2R38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MLTLTRIHTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQPLSNSDCVLLCL SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAINMLWMIANQANLWLAACLSLLYCSK LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNT RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRDSRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAVLISG NAKLRRAVTTILLWAQSSLKVRADHKADSRTLC
Uniprot No.

Target Background

Function
This receptor potentially plays a role in the perception of bitterness and is gustducin-linked. It may contribute to sensing the chemical composition of gastrointestinal content. The receptor's activity might stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Pan paniscus TAS2R38?

TAS2R38 from Pan paniscus is a G protein-coupled receptor (GPCR) belonging to the Class T2 (Taste 2) sensory receptors family. The protein consists of 333 amino acids with seven transmembrane domains characteristic of GPCRs . The full amino acid sequence begins with MLTLTRIHTVSY and includes distinct structural regions including N-terminal domain, transmembrane helices (TM1-TM7), and intracellular and extracellular loops . The protein's three-dimensional structure facilitates its function as a bitter taste receptor, with the transmembrane domains forming a pocket for ligand binding.

What expression systems are recommended for Pan paniscus TAS2R38?

For recombinant expression of Pan paniscus TAS2R38, several expression systems can be employed depending on research goals:

  • Mammalian cell lines (HEK293, CHO): Provide native-like post-translational modifications and membrane insertion

  • Insect cell systems (Sf9, Hi5): Offer higher protein yields while maintaining most post-translational modifications

  • Bacterial systems (E. coli): Useful for protein fragment expression but often challenging for full-length GPCRs

The gene can be cloned into expression vectors such as pcDNA3.1+/C-(K)DYK for mammalian expression . When designing expression constructs, consider incorporating purification tags that will not interfere with protein function, and codon optimization for the selected expression system to enhance yields.

How do polymorphisms in TAS2R38 affect its function in immune responses?

TAS2R38 polymorphisms significantly impact immune function through several mechanisms:

HaplotypeCommon NamePolymorphic SitesImmune FunctionClinical Correlation
PAV"Protective"Pro49, Ala262, Val296Enhanced NO production, Increased ciliary beat frequencyLower susceptibility to severe CRS
AVI"Non-protective"Ala49, Val262, Ile296Reduced NO production, Lower ciliary beat frequencyHigher vulnerability to CRS

The PAV haplotype (considered "protective") enhances the calcium-dependent production of nitric oxide (NO) and increases ciliary beat frequency (CBF) when the receptor is activated . This results in improved mucociliary clearance and stronger innate antimicrobial effects. Individuals with the PAV/PAV genotype ("supertasters") demonstrate enhanced immune responses compared to those with AVI/AVI genotype ("non-tasters") . When studying recombinant TAS2R38 from Pan paniscus, researchers should consider these functional variations and design experiments that account for potential haplotype differences.

What are the methodological considerations for studying TAS2R38-ligand interactions?

When investigating TAS2R38-ligand interactions, researchers should consider:

  • Ligand selection: Phenylthiocarbamide (PTC) is a well-established ligand for TAS2R38 testing . Other bitter compounds like 6-n-propylthiouracil (PROP) can also be used.

  • Assay development considerations:

    • Calcium mobilization assays: Measure receptor activation using calcium-sensitive dyes

    • Bioluminescence resonance energy transfer (BRET): Assess conformational changes upon ligand binding

    • Surface plasmon resonance (SPR): Determine binding kinetics and affinity

  • Controls: Include positive controls (known ligands) and negative controls (non-ligands) in each experiment.

  • Receptor variants: Test multiple haplotypes (PAV, AVI) to compare binding affinities and activation profiles.

When analyzing data, normalize responses to cell surface expression levels, as membrane localization efficiency can vary between experiments and affect apparent activity measurements.

How does recombinant Pan paniscus TAS2R38 perform in functional assays compared to native receptor?

Recombinant Pan paniscus TAS2R38 performance in functional assays may differ from the native receptor due to several factors:

  • Post-translational modifications: Recombinant systems may not reproduce all native modifications, potentially affecting receptor folding, trafficking, or signaling.

  • Membrane environment: Native lipid composition differs from expression systems, which can influence receptor dynamics and ligand interactions.

  • Coupling efficiency: G-protein coupling may vary between systems, affecting downstream signaling cascade efficiency.

To address these limitations, researchers should:

  • Compare multiple expression systems

  • Include positive controls with known activity profiles

  • Consider reconstitution in native-like lipid environments

  • Validate findings with native receptor sources when possible

Measuring parameters such as EC50 values, maximal response, and receptor desensitization patterns can provide insights into functional equivalence between recombinant and native receptors.

What are the optimal storage and handling conditions for recombinant Pan paniscus TAS2R38?

Optimal storage and handling of recombinant Pan paniscus TAS2R38 requires careful consideration of protein stability:

  • Storage recommendations:

    • Store at -20°C for routine use

    • For extended storage, maintain at -80°C

    • Use Tris-based buffer with 50% glycerol as a cryoprotectant

  • Handling guidelines:

    • Avoid repeated freeze-thaw cycles which can denature the protein

    • Prepare working aliquots for short-term use (store at 4°C for up to one week)

    • When thawing, use gentle methods (e.g., on ice) to preserve protein structure

  • Quality control:

    • Verify protein integrity by SDS-PAGE before experiments

    • Assess functionality using a standardized ligand-binding assay

    • Monitor batch-to-batch variation with consistent quality control protocols

For membrane-bound applications, consider reconstitution in appropriate lipid environments to maintain native-like conformation and functionality.

What methods are recommended for assessing TAS2R38 polymorphisms in research samples?

For analyzing TAS2R38 polymorphisms in research samples, several methods are available with varying degrees of throughput, sensitivity, and resource requirements:

  • PCR-based genotyping:

    • Allele-specific PCR for targeted SNP detection

    • Real-time PCR with allelic discrimination (as used in ref )

    • Restriction fragment length polymorphism (RFLP) analysis

  • Sequencing approaches:

    • Sanger sequencing for confirming specific variants

    • Next-generation sequencing for high-throughput analysis

    • Target-enrichment strategies for focused genomic regions

  • Functional assessment:

    • PTC taste testing (0.025% aqueous solution) as a phenotypic marker

    • Calcium mobilization assays to measure receptor activity

    • Ciliary beat frequency measurement for functional impact

When designing genotyping strategies, focus on the three key polymorphic sites (rs713598, rs1726866, rs10246939) that define the PAV and AVI haplotypes . Always include positive controls for each polymorphic variant and verify that genotype distributions conform to Hardy-Weinberg equilibrium in population studies.

How can researchers troubleshoot expression and purification issues with recombinant TAS2R38?

Common challenges in TAS2R38 expression and purification include low yields, aggregation, and loss of functionality. Here are systematic troubleshooting approaches:

IssuePotential CausesSolutions
Low expressionCodon bias, toxicity, inefficient transcriptionOptimize codons, use inducible systems, test different promoters
Protein aggregationImproper folding, hydrophobic interactionsAdd stabilizing agents, optimize detergents, lower expression temperature
Poor membrane insertionInefficient trafficking, improper signal sequenceUse GPCR-specific expression tags, optimize signal sequences
Low purification yieldInefficient extraction, protein instabilityTest different detergents, add stabilizers, optimize buffer conditions
Loss of functionalityDenaturation, improper refoldingValidate with functional assays at each purification step

When expressing membrane proteins like TAS2R38, consider using specialized expression systems designed for GPCRs and validate proper folding through ligand-binding assays throughout the purification process. For difficult constructs, fusion partners (e.g., maltose-binding protein, thioredoxin) may improve expression and solubility.

How can Pan paniscus TAS2R38 research contribute to understanding human respiratory conditions?

Research on Pan paniscus TAS2R38 provides valuable comparative insights for human respiratory conditions:

  • Evolutionary conservation: Comparing TAS2R38 across species helps identify functionally critical domains that could be targets for therapeutic development in respiratory conditions.

  • Polymorphism studies: The association between TAS2R38 haplotypes and chronic rhinosinusitis with nasal polyps (CRSwNP) demonstrates the receptor's role in upper respiratory health . In humans, the PAV haplotype is associated with:

    • Enhanced mucociliary clearance

    • Improved innate antimicrobial effects

    • Lower susceptibility to severe CRS

  • Functional mechanisms: TAS2R38 activation produces:

    • Calcium-dependent increase in nitric oxide (NO) production

    • Enhanced ciliary beat frequency (CBF)

    • Improved mucociliary clearance (MCC)

By studying these mechanisms in both humans and Pan paniscus, researchers can develop comparative models to better understand respiratory epithelial defense systems and identify potential therapeutic targets for conditions like chronic rhinosinusitis, respiratory infections, and inflammatory airway diseases.

What are the current contradictions or knowledge gaps in TAS2R38 research?

Despite significant advances, several knowledge gaps and contradictions exist in TAS2R38 research:

  • Functional diversity beyond taste:

    • While TAS2R38's role in bitter taste perception is well-established, its extra-oral functions require further characterization

    • The full spectrum of natural ligands that activate TAS2R38 in different tissues remains incompletely understood

  • Signaling pathway variations:

    • Different downstream effectors may be activated in various cell types

    • The relationship between receptor polymorphisms and signaling pathway efficiency needs further clarification

  • Evolutionary perspectives:

    • The selective pressures that maintained TAS2R38 polymorphisms across primate evolution remain debated

    • The functional significance of species-specific variations in receptor structure requires additional investigation

  • Clinical correlations:

    • While associations with upper respiratory conditions like CRS are emerging , the causal mechanisms require further elucidation

    • The potential for targeting TAS2R38 in therapeutic applications remains largely unexplored

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, functional genomics, evolutionary analysis, and clinical research.

What emerging technologies could advance Pan paniscus TAS2R38 research?

Several cutting-edge technologies hold promise for advancing TAS2R38 research:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of TAS2R38 in different conformational states

    • Provides insights into ligand binding without crystallization challenges

    • Allows comparison of structural differences between haplotypes

  • CRISPR-Cas9 genome editing:

    • Facilitates precise modification of TAS2R38 sequences

    • Enables creation of isogenic cell lines with different receptor variants

    • Supports in vivo studies of receptor function in model organisms

  • Single-cell technologies:

    • Reveal cell-specific expression patterns and responses

    • Identify rare cellular populations with unique TAS2R38 functions

    • Map receptor activity to specific cell states

  • Computational approaches:

    • Molecular dynamics simulations predict ligand-receptor interactions

    • Systems biology models integrate receptor function into cellular networks

    • AI-based drug discovery identifies novel modulators of receptor activity

These technological advances will help resolve current limitations in understanding TAS2R38 structure-function relationships and accelerate discovery of potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.