Recombinant Pan paniscus Taste receptor type 2 member 39 (TAS2R39)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms and Ligand Interactions

TAS2R39 is a gustducin-linked receptor that activates G-protein signaling cascades, leading to bitter taste perception and physiological responses. Its ligand specificity is broad but not universal.

Key Agonists

Ligand ClassExamples
FlavonoidsCatechins (green tea), isoflavones (soy), theaflavins (black tea), vanillin
Amino AcidsPhenylalanine (Phe), tryptophan (Trp), D-Trp (non-proteinogenic)
PeptidesTrp-Trp, Leu-Trp dipeptides; Trp-Trp-Trp, Leu-Leu-Leu tripeptides

Antagonists

Ligand ClassExamples
FlavonesLuteolin, baicalein (stereochemical flexibility inhibits receptor activation)

The receptor’s activation triggers enterohormone secretion (e.g., cholecystokinin) and modulates food intake . In extraoral tissues, it may influence respiratory inflammation and gastrointestinal motility .

Research Applications

Recombinant TAS2R39 is pivotal for studying bitter taste biology and receptor-targeted therapies:

Taste Perception Studies

  • Mechanistic Insights: Used to map ligand-binding pockets and G-protein coupling dynamics .

  • Species-Specific Receptor Comparisons: Helps identify conserved and divergent bitter taste mechanisms between primates and humans .

Drug Development

  • Antagonist Screening: Flavone derivatives are tested for anti-inflammatory or appetite-modulating properties .

  • Food Science: Evaluates bitterness in plant-derived compounds (e.g., green tea catechins) .

Extraoral Functions

  • Respiratory Research: Investigates roles in allergic rhinitis and cytokine signaling .

  • Gastrointestinal Studies: Explores receptor-mediated food intake regulation .

Experimental Challenges and Future Directions

While recombinant TAS2R39 provides a robust model, challenges remain:

  1. Low Expression in Native Tissues: Gene expression levels are often low, complicating detection in vivo .

  2. Ligand Specificity: Overlapping agonist profiles with other TAS2Rs (e.g., TAS2R1, TAS2R4) require careful validation .

  3. Structural Elucidation: No high-resolution crystal structures are available, limiting detailed mechanistic studies .

Future research may focus on:

  • Crystallography: Solving the receptor’s 3D structure to design targeted ligands.

  • Therapeutic Applications: Exploiting TAS2R39 antagonists for metabolic or respiratory disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R39; Taste receptor type 2 member 39; T2R39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHA AEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINIC TVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTL HMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIM AAYPAGHSILPIQDNPGLRRAWKRLQLRLHLYPKEWTL
Uniprot No.

Target Background

Function
This receptor potentially plays a role in the perception of bitterness and is linked to gustducin. It might contribute to sensing the chemical composition of gastrointestinal content. Activation of this receptor could stimulate alpha gustducin, mediate PLC-beta-2 activation, and subsequently lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the functional role of TAS2R39 in Pan paniscus compared to other primates?

TAS2R39 belongs to the TAS2R (taste receptor type 2) family of G protein-coupled receptors that mediate bitter taste perception. In primates, these receptors exhibit variable receptor tuning breadth, ranging from narrowly tuned receptors that respond to specific bitter compounds to broadly tuned receptors that recognize numerous ligands . Based on comparative analyses of bitter taste receptors across species, TAS2R39 likely contributes to the detection of specific bitter compounds relevant to the bonobo diet and environment.

Unlike mice, which possess more narrowly tuned bitter taste receptors, primates generally have more broadly tuned receptors, suggesting different evolutionary pressures on taste perception systems . The specific agonist profile of Pan paniscus TAS2R39 would need to be experimentally determined using methods similar to those applied for mouse and human taste receptors, including heterologous expression systems and calcium imaging assays.

What expression systems are most suitable for studying recombinant Pan paniscus TAS2R39?

For functional studies of recombinant TAS2R39 from Pan paniscus, heterologous expression systems similar to those used for other taste receptors would be appropriate. Based on established methodologies for bitter taste receptor research, the following expression systems are recommended:

  • HEK293T cells: These cells provide high transfection efficiency and robust protein expression. For optimal results, co-expression with chimeric G proteins (such as Gα16gust44) is recommended to couple receptor activation to calcium signaling pathways that can be measured using fluorescent calcium indicators .

  • Xenopus oocytes: This system allows for electrophysiological measurements when the receptor is co-expressed with appropriate G proteins and downstream effectors.

When establishing these systems, researchers should validate expression through techniques such as qRT-PCR or western blotting, similar to the validation approaches used for mouse Tas2r receptors .

How does the TM domain structure of TAS2R39 influence its function?

TAS2R39, like other taste receptors in the TAS2R family, features a seven-transmembrane (7TM) domain structure characteristic of G protein-coupled receptors . Each transmembrane domain contributes differently to receptor function:

  • TM3, TM5, and TM6 likely contain residues critical for ligand binding, as observed in other GPCRs

  • The extracellular loops, particularly ECL2, may play a role in initial ligand recognition

  • The intracellular loops interact with G proteins to initiate downstream signaling

Transmembrane DomainPredicted Functional Role in TAS2R39
TM1Structural stabilization
TM2Conformational changes during activation
TM3Critical for ligand binding pocket formation
TM4Structural support
TM5Contains residues for ligand interaction
TM6Undergoes conformational changes during activation
TM7Contains conserved motifs important for activation

Site-directed mutagenesis studies would be necessary to identify specific residues critical for ligand binding and receptor activation in Pan paniscus TAS2R39, similar to studies performed with human TAS2Rs .

What methods are most reliable for detecting TAS2R39 expression in native tissues?

For detecting native TAS2R39 expression in Pan paniscus taste tissues, researchers should consider complementary approaches:

  • Quantitative RT-PCR (qRT-PCR): This method provides sensitive quantification of mRNA expression levels. Design primers specific to Pan paniscus TAS2R39, with appropriate reference genes for normalization. Based on approaches used for mouse taste receptors, SYBR Green or TaqMan-based systems can be employed .

  • In situ hybridization: This technique allows visualization of receptor expression in specific cell types within taste buds. As demonstrated with mouse bitter taste receptors, this approach can confirm qRT-PCR findings and provide spatial information about receptor expression patterns .

  • Immunohistochemistry: Using specific antibodies against TAS2R39, though antibody specificity should be rigorously validated due to the high sequence similarity among TAS2R family members.

The correlation between qRT-PCR data and in situ hybridization results, as observed with mouse Tas2r receptors, provides more reliable evidence of expression patterns than either method alone .

What are the key considerations when designing primers for Pan paniscus TAS2R39 cloning?

When designing primers for cloning Pan paniscus TAS2R39:

  • Sequence specificity: Design primers that specifically target TAS2R39 and avoid cross-amplification of other TAS2R family members. Analyze sequence alignments of multiple TAS2R genes from Pan paniscus to identify unique regions.

  • Restriction enzyme sites: Include appropriate restriction sites at the 5' ends of primers to facilitate directional cloning into expression vectors. Allow 3-6 nucleotides 5' to the restriction site to ensure efficient enzyme digestion.

  • Kozak sequence: Include a Kozak consensus sequence (GCCACC) immediately upstream of the start codon to enhance translation efficiency in mammalian expression systems.

  • Epitope tags: Consider incorporating sequences for epitope tags (e.g., FLAG, HA) to facilitate detection and purification of the expressed receptor.

  • Codon optimization: For improved expression in heterologous systems, codon optimization for the host cell system may be beneficial.

The amplified TAS2R39 sequence should be verified by sequencing to ensure no mutations were introduced during PCR amplification.

What are the most effective methodologies for measuring TAS2R39 activation in heterologous systems?

For quantitative assessment of Pan paniscus TAS2R39 activation, calcium imaging represents the gold standard methodology, as demonstrated in comprehensive analyses of mouse and human bitter taste receptors . The recommended protocol includes:

  • Cell preparation: Transfect HEK293T cells with the TAS2R39 expression construct and a chimeric G protein (e.g., Gα16gust44) to couple receptor activation to calcium signaling.

  • Calcium indicator loading: Load cells with a calcium-sensitive fluorescent dye such as Fluo-4-AM or Fura-2-AM.

  • Automated fluorescence measurement: Use a fluorescence plate reader or imaging system capable of detecting rapid calcium transients. For high-throughput screening, a FLIPR (Fluorometric Imaging Plate Reader) system is ideal.

  • Data analysis: Calculate response parameters as follows:

    • Signal amplitude (ΔF/F): Maximum fluorescence change relative to baseline

    • Threshold concentration: Lowest concentration producing a measurable response

    • EC50 values: Concentration producing half-maximal response

    • Dose-response relationships: Plot using nonlinear regression analysis

For optimal results, include positive controls (receptors with known agonists) and negative controls (mock-transfected cells) in each experiment. Signal normalization to a standard agonist can facilitate comparison across experiments .

How do sequence variations between human and Pan paniscus TAS2R39 influence agonist profiles?

Sequence variations between human and Pan paniscus TAS2R39 may significantly alter their agonist profiles. Based on observations from orthologous taste receptors, even small sequence differences can lead to distinctly different functional properties . To systematically investigate these differences:

  • Sequence alignment and analysis: Identify amino acid differences between human and Pan paniscus TAS2R39, with particular focus on transmembrane domains and extracellular loops.

  • Homology modeling: Generate structural models based on available GPCR crystal structures to predict how sequence variations might affect the binding pocket.

  • Systematic agonist screening: Test a diverse panel of bitter compounds (similar to the 128 compounds used for mouse Tas2r characterization) against both receptors using calcium imaging assays .

  • Chimeric receptor approach: Create chimeric receptors by swapping domains between human and Pan paniscus TAS2R39 to identify regions responsible for differences in agonist recognition.

  • Site-directed mutagenesis: Mutate specific amino acids that differ between species to directly test their contribution to agonist specificity.

Studies with mouse and human bitter taste receptors have demonstrated that orthologous receptors often recognize different sets of compounds, reflecting species-specific adaptations to dietary environments .

What approaches can identify novel agonists and antagonists for Pan paniscus TAS2R39?

For comprehensive identification of compounds that interact with Pan paniscus TAS2R39:

  • High-throughput screening (HTS): Test large compound libraries using calcium imaging in cells expressing TAS2R39. This approach has successfully identified numerous agonists for other bitter taste receptors .

Screening MethodAdvantagesLimitations
Chemical library screeningDiscovers diverse chemical structuresRequires large-scale screening capabilities
Natural product extractsIdentifies biologically relevant compoundsComplex mixtures require deconvolution
In silico screeningCost-effective initial filteringRequires structural information
Fragment-based screeningIdentifies building blocks for ligand designTypically identifies weak initial hits
  • Structure-activity relationship analysis: Once initial hits are identified, test structural analogs to determine chemical features required for receptor activation or inhibition.

  • Cross-species comparison: Test compounds known to activate human TAS2R39, as there may be overlapping agonist profiles despite sequence differences.

  • Natural product screening: Test compounds from plants in the native habitat of Pan paniscus to identify ecologically relevant ligands.

For each potential agonist, determine threshold concentration, EC50, and efficacy (maximum response) to create a comprehensive pharmacological profile .

What are the key considerations for analyzing TAS2R39 ligand interaction using mutagenesis studies?

When conducting mutagenesis studies to analyze Pan paniscus TAS2R39 ligand interactions:

  • Target selection strategy:

    • Focus on residues in transmembrane domains 3, 5, 6, and 7, which typically form the binding pocket in GPCRs

    • Target residues that differ between species with known functional differences

    • Consider conserved motifs among bitter taste receptors

  • Mutation design principles:

    • Conservative substitutions (maintaining physicochemical properties) to test structural requirements

    • Non-conservative substitutions to test functional requirements

    • Alanine scanning to identify critical residues

  • Functional validation methods:

    • Measure changes in EC50 values for known agonists

    • Assess changes in efficacy (maximum response)

    • Test shifts in agonist selectivity profiles

  • Expression control measures:

    • Verify expression levels of mutant receptors through epitope tags

    • Ensure proper membrane localization using fluorescent protein tags or immunocytochemistry

    • Include wild-type receptor controls in each experiment

The dramatic differences in agonist recognition between orthologous receptors in different species, as observed between mouse Tas2r138 and human TAS2R38, highlight the importance of specific amino acid residues in determining receptor function .

How can evolutionary analysis of TAS2R39 inform our understanding of bitter taste perception in primates?

Evolutionary analysis of TAS2R39 across primate species can provide valuable insights into bitter taste adaptation:

  • Phylogenetic analysis: Construct phylogenetic trees based on TAS2R39 sequences from multiple primate species to identify evolutionary relationships and divergence patterns.

  • Selection pressure analysis: Calculate dN/dS ratios (non-synonymous to synonymous substitution rates) to identify regions under positive selection, which may indicate functional adaptation to different ecological niches.

  • Correlation with dietary preferences:

    • Compare TAS2R39 sequence variations with dietary specializations across primate species

    • Identify specific amino acid changes that correlate with dietary shifts

  • Ancestral sequence reconstruction: Infer ancestral TAS2R39 sequences to study the functional evolution of bitter taste perception throughout primate evolution.

This approach aligns with observations from mouse and human bitter taste receptors, where species-specific expansions and modifications of the receptor repertoire reflect adaptation to different dietary environments and toxic compound exposure .

What methods are most appropriate for studying TAS2R39 dimerization and interaction with signaling partners?

To investigate TAS2R39 dimerization and interactions with signaling partners:

  • Resonance energy transfer techniques:

    • FRET (Fluorescence Resonance Energy Transfer): Tag TAS2R39 with donor and acceptor fluorophores to detect proximity in living cells

    • BRET (Bioluminescence Resonance Energy Transfer): Use luciferase and fluorescent protein tags to minimize photobleaching and autofluorescence issues

  • Co-immunoprecipitation:

    • Use epitope-tagged versions of TAS2R39 to pull down potential interaction partners

    • Mass spectrometry analysis to identify novel binding partners

  • Functional complementation assays:

    • Split reporter systems (e.g., split luciferase) to detect protein-protein interactions

    • Bimolecular fluorescence complementation (BiFC) to visualize interaction sites within cells

  • Crosslinking approaches:

    • Chemical crosslinking followed by proteomic analysis

    • Photo-crosslinking using unnatural amino acids incorporated at specific positions

For all these methods, appropriate controls must be included to distinguish specific from non-specific interactions. Verification through multiple, orthogonal methods provides the strongest evidence for genuine interactions.

How can computational modeling enhance our understanding of TAS2R39 structure-function relationships?

Computational modeling approaches provide valuable insights into TAS2R39 structure and function:

  • Homology modeling: Despite limited structural information for taste receptors, homology models can be constructed based on other GPCR crystal structures. These models should be refined using:

    • Molecular dynamics simulations to test stability

    • Energy minimization to optimize geometry

    • Validation through comparison with experimental mutagenesis data

  • Ligand docking simulations:

    • Virtual screening of compound libraries to identify potential ligands

    • Binding mode prediction for known agonists and antagonists

    • Structure-activity relationship analysis to guide compound optimization

  • Molecular dynamics simulations:

    • Analyze conformational changes during receptor activation

    • Investigate water networks and ion binding sites

    • Study interactions with lipid bilayers and their influence on receptor function

  • Machine learning approaches:

    • Develop predictive models for compound activity based on chemical features

    • Identify patterns in receptor-ligand interactions across the TAS2R family

These computational approaches complement experimental methods and can guide the design of more targeted experiments, potentially reducing the need for exhaustive screening of compound libraries .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.