Recombinant Pan paniscus Taste receptor type 2 member 41 (TAS2R41)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Pan paniscus Taste Receptor Type 2 Member 41 (TAS2R41) is a genetically engineered protein belonging to the TAS2R family of G protein-coupled receptors (GPCRs). These receptors are primarily responsible for detecting bitter compounds, serving as a defense mechanism against toxic substances . TAS2R41 is expressed in Pan paniscus (bonobo) and shares structural and functional homology with human orthologs, though species-specific variations exist . Recombinant production enables biochemical and pharmacological studies to elucidate its ligand specificity, signaling mechanisms, and evolutionary adaptations .

Protein Architecture

TAS2R41 adopts a canonical GPCR structure with:

  • Seven transmembrane domains (TM1–TM7) linked by intra- and extracellular loops .

  • N-terminal extracellular domain and C-terminal intracellular domain .

  • Low sequence homology (<30%) with other GPCR classes, complicating structural modeling .

Ligand Specificity

TAS2R41 is a "specialist" receptor with high selectivity for specific ligands:

  • Chloramphenicol: Identified as a potent agonist in human TAS2R41, with EC₅₀ values in micromolar ranges .

  • Genetic Variants: Functional haplotypes influence ligand efficacy. Non-functional variants may explain historical challenges in deorphanizing this receptor .

Table 2: Agonist Profile of TAS2R41 (Human Ortholog Reference)

AgonistReceptor ResponseSelectivityStudy Model
ChloramphenicolStrong activationTAS2R41-specificHEK293 cells
Other compoundsNo responseN/AHigh-throughput screening

Signaling Pathways

  • Bitter compounds activate TAS2R41, triggering Gα-gustducin signaling.

  • Downstream effects include calcium release and potassium channel modulation, though exact pathways in Pan paniscus remain uncharacterized .

Pharmacological Studies

Recombinant TAS2R41 facilitates:

  • Drug Development: Screening bitter-masking agents for pharmaceuticals .

  • Toxicology: Assessing toxin detection mechanisms in primates .

Evolutionary Biology

  • Gene Duplication: TAS2R genes, including TAS2R41, show lineage-specific expansions in primates, correlating with dietary adaptations .

  • Genetic Diversity: Nonsynonymous polymorphisms in TAS2R loci suggest ongoing selective pressures .

Recombinant Expression

  • Host System: E. coli for cost-effective, high-yield production .

  • Purification: Affinity chromatography via His tag .

  • Reconstitution: Requires glycerol (5–50%) for stability; avoid repeated freeze-thaw cycles .

Challenges

  • Low Solubility: Common in membrane-bound GPCRs, necessitating detergent use .

  • Functional Validation: Requires heterologous systems (e.g., HEK293) for ligand screening .

Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography to resolve activation mechanisms .

  • Cross-Species Comparisons: Functional studies comparing Pan paniscus and human TAS2R41 to identify evolutionary divergences .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
TAS2R41; Taste receptor type 2 member 41; T2R41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MQAALTAFFMLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQL VGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHPTFL WLKWRFPAWVPWLLLGSVLISFIITLLFFWVNYPAYQEFLIRKFSVNMTYKWNTRIETYY FPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFL ILYALSFLSLIIDATKFISMQNDFYWPWQIAVYLCISIHPFILIFSNLKLRSVFSQLLLL ARGFWVA
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It could potentially contribute to sensing the chemical composition of gastrointestinal content. The activity of this receptor might stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are Taste Receptor Type 2 (TAS2R) proteins and what is their primary function?

Taste Receptor Type 2 (TAS2R) proteins are G protein-coupled receptors responsible for detecting bitter compounds. Bitterness is perceived by activation of at least 25 different bitter taste receptors located in taste buds . These receptors serve an important evolutionary function by helping organisms detect potentially harmful substances.

Recent research has demonstrated that TAS2Rs are expressed in multiple tissues beyond the oral cavity, including the respiratory system, gastrointestinal tract, and brain, suggesting they have broader physiological functions beyond taste perception . For example, TAS2R expression has been detected in the brain stem, cerebellum, cortex, and nucleus accumbens, where they respond to bitter compounds like denatonium benzoate and quinine .

How are recombinant TAS2R proteins from Pan paniscus typically expressed and purified?

Based on information from related TAS2R family members (TAS2R45 and TAS2R10), recombinant Pan paniscus taste receptors are typically expressed in E. coli with N-terminal His tags to facilitate purification . The expressed proteins are generally provided as lyophilized powders with purity greater than 90% as determined by SDS-PAGE .

The expression constructs typically contain the full-length protein sequence. For context, TAS2R45 is 309 amino acids and TAS2R10 is 307 amino acids in length . While specific expression data for TAS2R41 from Pan paniscus is not provided in the search results, similar heterologous expression systems would likely be applicable, including E. coli, yeast, baculovirus, or mammalian cell systems, as noted for rat TAS2R41 .

What are the optimal storage and reconstitution conditions for recombinant TAS2R proteins?

The optimal storage conditions for recombinant TAS2R proteins include:

  • Store at -20°C/-80°C upon receipt

  • Aliquot for multiple use to avoid repeated freeze-thaw cycles, which can degrade protein quality

  • Working aliquots may be stored at 4°C for up to one week

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Default final concentration of glycerol is typically 50%

For rat TAS2R41, the protein is provided in liquid form containing glycerol, with recommended storage at -20°C for long-term storage, and working aliquots can be stored at 4°C for up to one week .

How do expression systems affect the functionality of recombinant TAS2R proteins?

The choice of expression system significantly impacts the functionality of recombinant TAS2R proteins:

  • E. coli expression systems:

    • Advantages: High yield, simplicity, cost-effectiveness

    • Limitations: Lack of post-translational modifications, potential improper folding for membrane proteins

    • Applications: Structural studies, antibody production

  • Yeast expression systems:

    • Advantages: Some eukaryotic post-translational modifications, higher yield than mammalian systems

    • Limitations: Glycosylation patterns differ from mammalian cells

    • Applications: Functional studies requiring basic post-translational modifications

  • Baculovirus expression systems:

    • Advantages: More complex post-translational modifications, relatively high yield

    • Limitations: More complex and time-consuming than bacterial systems

    • Applications: Functional studies requiring proper receptor folding

  • Mammalian cell expression systems:

    • Advantages: Native-like post-translational modifications, proper protein folding

    • Limitations: Lower yield, higher cost

    • Applications: Functional assays requiring fully native receptor properties

For TAS2R41 specifically, the choice would depend on the research goals. For structural studies, E. coli may be sufficient, but for functional assays of receptor activation, mammalian expression systems might be preferred despite lower yields.

What experimental approaches are most effective for evaluating TAS2R activation and signaling?

Effective approaches for evaluating TAS2R activation include:

  • Calcium imaging assays: TAS2Rs couple to G proteins, leading to intracellular calcium release. Studies have shown that bitter tastants can increase intracellular Ca2+ concentrations in cells expressing bitter taste receptors . This provides a direct readout of receptor activation.

  • Functional signaling assays: Expression of multiple T2R receptors has been found in enteroendocrine cell lines like STC-1. Adding bitter compounds (denatonium, phenylthiocarbamide, 6-n-propyl-2-thiouracil, and cycloheximide) to these cells promotes rapid increases in intracellular Ca2+ concentration, confirming functional activity .

  • In vivo physiological response measurements: In airway smooth muscle, TAS2R activation paradoxically causes relaxation and dilation of airways that has been measured to be threefold greater than that elicited by β-adrenergic receptor agonists .

For TAS2R41 specifically, these methods could be adapted to characterize its activation by potential ligands, particularly focusing on calcium flux measurements as an indicator of receptor activity.

What is the current understanding of TAS2R expression beyond taste tissues?

Research has demonstrated TAS2R expression in multiple non-gustatory tissues:

  • Respiratory system: TAS2Rs in airway smooth muscle cells mediate bronchodilation when activated by bitter compounds. Studies indicate bitter tastants cause relaxation of airway smooth muscle that is associated with localized Ca2+ response at the cell membrane, which opens large-conductance Ca2+-activated K+ (BKCa) channels, leading to airway smooth muscle membrane hyperpolarization .

  • Gastrointestinal tract: TAS2Rs are expressed in enteroendocrine cells and a subset of colonic goblet cells. Research has demonstrated that "a subset of colonic goblet cells express Tas2r131" in mice . The expression pattern suggests roles in defense mechanisms against potentially harmful xenobiotics.

  • Brain: RT-PCR analysis has revealed the presence of T2R4, T2R107, and T2R38 transcripts in the brain stem, cerebellum, cortex, and nucleus accumbens . Functional assays have shown these receptors respond to bitter compounds like denatonium benzoate and quinine.

The diverse expression patterns suggest TAS2Rs may have evolved for functions beyond taste perception, including chemical sensing in various tissues, regulation of secretory processes, and potential roles in innate defense mechanisms.

How can comparative analysis of TAS2R sequences inform our understanding of bitter taste evolution?

Comparative analysis of TAS2R sequences across primates provides valuable insights into bitter taste evolution:

  • Sequence comparison between closely related species like Pan paniscus (bonobo), other great apes, and humans can reveal conserved regions critical for receptor function versus variable regions that may reflect adaptation to different ecological niches.

  • The availability of specific sequences for TAS2R45 and TAS2R10 from Pan paniscus allows direct comparison with human orthologs to identify species-specific variations that might correlate with dietary preferences or exposure to different environmental bitter compounds.

  • Expression patterns in non-taste tissues across species can inform understanding of the broader physiological roles these receptors may play. For example, the presence of bitter taste receptors in a subset of colonic goblet cells suggests roles in defense mechanisms against potentially harmful xenobiotics .

By examining the receptor sequences across species and correlating structural differences with functional variations, researchers can better understand how these receptors evolved to meet species-specific needs for detecting potentially harmful compounds.

What techniques are most effective for validating antibody specificity for TAS2R proteins?

Effective antibody validation techniques for TAS2R proteins include:

  • Expression system controls:

    • Testing in heterologous cells transfected with the specific TAS2R versus empty vector

    • Parallel testing in tissues with confirmed receptor expression versus negative controls

  • Cross-reactivity assessment:

    • Testing against closely related TAS2R family members to ensure specificity

    • Peptide competition assays using the immunizing peptide

    • Testing across species to confirm specificity and cross-reactivity

  • Correlation with mRNA expression:

    • Comparing protein detection with mRNA expression patterns via RT-PCR

    • This is particularly relevant as studies have used RT-PCR to detect TAS2R transcripts in various tissues

The high sequence similarity between TAS2R family members makes antibody specificity particularly challenging, necessitating rigorous validation across multiple assays to ensure reliable detection of the specific receptor of interest.

What are the recommended protocols for sample preparation to maintain TAS2R protein integrity?

Recommended protocols for TAS2R sample preparation include:

  • For lyophilized recombinant proteins (like TAS2R45 and TAS2R10):

    • Brief centrifugation prior to opening to bring contents to the bottom

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol for long-term storage

  • For storage and handling:

    • Store at -20°C/-80°C upon receipt

    • Aliquot for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots may be stored at 4°C for up to one week

  • For experimental use:

    • Prepare fresh working solutions before experiments

    • Maintain constant temperature during handling (typically 4°C)

    • Include protease inhibitors in buffers to prevent degradation

These protocols help maintain protein stability and functionality, which is particularly important for membrane proteins like TAS2Rs that can be challenging to work with due to their hydrophobic nature.

What quality control measures should be implemented to ensure reliable TAS2R functional assays?

Essential quality control measures include:

  • Protein characterization:

    • Verification of protein integrity via SDS-PAGE (>90% purity as noted for recombinant TAS2R proteins)

    • Confirmation of expected molecular weight

    • Assessment of proper folding and post-translational modifications

  • Functional validation:

    • Dose-response testing with known ligands

    • Calcium imaging assays to confirm receptor functionality, as bitter tastants promote rapid increases in intracellular Ca2+ concentration in cells expressing functional TAS2Rs

    • Inclusion of positive and negative controls in each experiment

  • Experimental consistency:

    • Standardized protocols for reagent preparation and storage

    • Consistent cell culture conditions and passage numbers

    • Regular validation of assay performance with reference compounds

  • Data analysis standards:

    • Appropriate statistical methods for analyzing dose-response relationships

    • Consistent normalization procedures

    • Clear criteria for defining receptor activation thresholds

Implementation of these measures ensures that results are reproducible and reliable, particularly important when working with challenging membrane proteins like TAS2Rs.

How might the study of TAS2R41 contribute to understanding extra-oral bitter sensing?

The study of TAS2R41 could significantly advance our understanding of extra-oral bitter sensing in several ways:

  • By examining TAS2R41 expression in tissues beyond the oral cavity, researchers can expand on existing findings showing TAS2R expression in the brain, respiratory system, and gastrointestinal tract . This could reveal tissue-specific functions of this particular receptor.

  • Functional studies comparing TAS2R41 signaling in taste versus non-taste tissues could elucidate potential differences in downstream signaling pathways. For example, in airway smooth muscle, TAS2R activation leads to bronchodilation through a mechanism involving large-conductance Ca2+-activated K+ channels .

  • Investigation of TAS2R41 ligand specificity across different tissues could reveal whether the same receptor responds to different compounds depending on its cellular context, potentially explaining the diverse physiological responses observed in different systems.

  • Comparative studies of TAS2R41 from Pan paniscus versus other species could provide evolutionary insights into how these receptors have adapted to serve both gustatory and extra-oral functions across different environmental niches.

What therapeutic applications might emerge from research on TAS2R family members?

Several promising therapeutic applications could emerge from TAS2R research:

  • Respiratory disease treatments: Research has shown that bitter tastants cause relaxation of airway smooth muscle that is "threefold greater than that elicited by β-adrenergic receptor agonists" . This suggests TAS2R agonists could become novel bronchodilators for treating conditions like asthma and COPD.

  • Gastrointestinal modulators: Given the expression of TAS2Rs in enteroendocrine cells and colonic goblet cells , targeting these receptors might provide new approaches for modulating gut hormone secretion, intestinal motility, or mucosal defense mechanisms.

  • Taste modification: Understanding the molecular basis of bitter taste perception could lead to more effective bitter blockers to improve medication adherence, particularly for pediatric formulations, by masking unpleasant tastes.

  • Neuropharmacological applications: The presence of functional TAS2Rs in brain regions including the brain stem, cerebellum, cortex, and nucleus accumbens suggests potential neurological applications, though these remain to be fully explored.

The development of specific TAS2R41 modulators could contribute to these therapeutic areas, particularly if this receptor has unique expression patterns or ligand specificities compared to other family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.