Recombinant Pan paniscus Taste receptor type 2 member 43 (TAS2R43)

Shipped with Ice Packs
In Stock

Description

Definition and Classification of Recombinant Pan paniscus Taste Receptor Type 2 Member 43 (TAS2R43)

Recombinant Pan paniscus TAS2R43 is a synthetic version of the bitter taste receptor protein produced through heterologous expression systems. It belongs to the TAS2R (Taste 2 Receptor) family, which comprises ~25 G-protein-coupled receptors (GPCRs) responsible for detecting bitter compounds in mammals . TAS2R43 specifically mediates bitter taste perception by transducing signals from bitter molecules to intracellular pathways . The recombinant form is engineered to include affinity tags (e.g., His-tag or GST) for purification and functional studies .

Production and Purification

Recombinant TAS2R43 is synthesized using two primary systems:

Expression SystemTagPurityYieldApplications
E. coliHis-tag>90%HighLigand-binding assays, structural studies
Wheat germGST>80%ModerateFunctional studies, antibody development
  • E. coli expression: Produces full-length TAS2R43 with an N-terminal His-tag for nickel affinity chromatography .

  • Wheat germ: Uses an in vitro system to preserve native folding, yielding GST-tagged protein for immunoaffinity purification .

Storage: Lyophilized powder stored at -20°C/-80°C. Reconstitution requires deionized water with glycerol (50% final concentration) .

Functional Applications in Research

Recombinant TAS2R43 is utilized to study bitter taste biology and ligand-receptor interactions:

Ligand Screening

  • Bitter compounds: TAS2R43 responds to aristolochic acid (a carcinogenic plant toxin) and grosheimin (a bitter sesquiterpene) .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences. Please indicate your requirement when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your needs.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R43; Taste receptor type 2 member 43; T2R43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW VLLLNWYLTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATSLSIFYLLKIANFSNFIFLH LKRRVKSVILVMLLGPLLFLACHLFMINMNEIVRTKEFDGNMTWKIKLKSAMYFSNMTVT MVANLVPFTLTLLSFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYW VKGEKTSSP
Uniprot No.

Target Background

Function
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the sulfonyl amide sweeteners saccharin and acesulfame K. In airway epithelial cells, binding of bitter compounds elevates intracellular calcium ion concentration and stimulates ciliary beat frequency. It may function as chemosensory receptors in airway epithelial cells, detecting and eliminating potential noxious agents from the airways.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane.

Q&A

What is TAS2R43 and how does it function in bitter taste perception?

TAS2R43 is a G protein-coupled receptor belonging to the TAS2R (taste receptor type 2) family responsible for bitter taste perception. It functions by binding to bitter compounds and initiating signal transduction cascades that ultimately lead to taste perception. Bitter taste receptors like TAS2R43 show selective activation patterns in response to specific bitter compounds, which affects sensory perception and downstream physiological responses .

In experimental systems, TAS2R43 activation can be studied using cell-based assays where the receptor is expressed in heterologous cell systems (such as HEK293 cells) coupled with calcium flux measurements to detect activation. Research has shown that TAS2R43 is exquisitely sensitive to certain bitter compounds, including some found in chicory and coffee .

How are recombinant taste receptors typically produced for research?

Recombinant taste receptors are typically produced using bacterial expression systems like E. coli, similar to the method used for TAS2R4 from Pan paniscus. The general protocol involves:

  • Cloning the full-length coding sequence into an expression vector with an appropriate tag (e.g., His-tag)

  • Transforming the construct into an expression host (e.g., E. coli)

  • Inducing protein expression under optimized conditions

  • Purifying the recombinant protein using affinity chromatography

  • Confirming protein identity and purity using methods such as SDS-PAGE

For TAS2R proteins, it's important to note that they are typically lyophilized and stored with stabilizing agents like trehalose to maintain their structure and function .

What is the evolutionary significance of TAS2R43 in primates?

Bitter taste receptor genes have undergone significant evolution in primates, with gene duplication events occurring in specific lineages. Studies have revealed that the total number of TAS2R genes in primates ranges from 27 to 51, with phylogenetic analysis showing that these genes can be divided into 21 distinct clades .

Research indicates that dietary preferences have shaped the TAS2R repertoire in primates, with phylogenetically independent contrast analysis showing significant correlation between the number of intact TAS2R genes and feeding preferences . This suggests that TAS2R43 and other bitter taste receptors have evolved in response to specific environmental and dietary challenges faced by different primate species.

What are the optimal expression systems for functional studies of recombinant Pan paniscus TAS2R43?

For functional studies of TAS2R43, inducible mammalian expression systems have proven more effective than bacterial systems. Based on protocols for related bitter taste receptors, the recommended approach includes:

  • Using FLP-In T-REX 293-Gα16gust44 cells for stable inducible expression

  • Transfecting cells with TAS2R43 cDNA in pcDNA5/FRT/TO vector alongside the FLP-recombinase encoding plasmid pOG44

  • Selecting successfully integrated cells using hygromycin B (100 μg/ml)

  • Inducing receptor expression with tetracycline (5 μg/mL) for 14-18 hours prior to experiments

For calcium imaging assays to assess receptor function, cells should be loaded with calcium-sensitive dyes and exposed to potential ligands while monitoring fluorescence changes. Aristolochic acid has been used as a positive control for TAS2R43 activation in functional studies .

How can researchers differentiate the activation patterns of TAS2R43 from other TAS2R family members?

Differentiating activation patterns requires careful experimental design with the following considerations:

  • Selective agonists: Use compounds with known selectivity profiles. For example, certain bitter compounds from chicory (lactucin, lactucopicrin, and 11β,13-dihydrolactucin) have shown selective activation of TAS2R43 and TAS2R46 .

  • Receptor-specific controls: Include cells expressing single TAS2R subtypes (TAS2R43, TAS2R14, TAS2R46, etc.) alongside cells expressing TAS2R43 to determine cross-reactivity.

  • Dose-response experiments: Generate concentration-response curves (0.01-100 μM) to determine EC50 values for different ligands at different receptors .

  • Molecular inhibition: Use siRNA or CRISPR-based approaches to selectively knock down specific TAS2R family members to confirm specificity.

The table below illustrates typical activation profiles for different bitter taste receptors based on research with related compounds:

Bitter CompoundTAS2R43 Activation (EC50)TAS2R46 Activation (EC50)TAS2R14 Activation (EC50)
LactucinHigh sensitivityHigh sensitivityLow/No activation
LactucopicrinHigh sensitivityHigh sensitivityLow/No activation
Aristolochic acidPositive controlVariable sensitivityPositive control
StrychnineLow sensitivityPositive controlLow sensitivity

What are the technical challenges in studying ligand binding to recombinant Pan paniscus TAS2R43?

Several technical challenges exist when studying ligand binding to recombinant TAS2R43:

  • Protein stability: Bitter taste receptors are inherently unstable when purified. Inclusion of 6% trehalose in storage buffers and avoiding repeated freeze-thaw cycles can help maintain protein integrity .

  • Membrane protein reconstitution: As a GPCR, TAS2R43 requires a lipid environment for proper folding and function. Reconstitution into lipid nanodiscs or liposomes may be necessary for binding studies.

  • Detection of binding events: Direct binding assays using fluorescently labeled ligands or radioligand binding assays are challenging due to the relatively low affinity of many bitter compounds. Functional assays (e.g., calcium flux) are often more practical for determining binding interactions .

  • Species-specific variations: While Pan paniscus (bonobo) and human TAS2R43 share high sequence homology, subtle differences may affect ligand specificity. Comparative studies examining responses to the same compounds across species can help identify these differences.

How should researchers design experiments to compare TAS2R43 function across primate species?

To effectively compare TAS2R43 function across primate species, consider the following experimental design:

  • Sequence homology analysis: First perform phylogenetic analysis to understand the evolutionary relationships between TAS2R43 variants across species. TAS2R genes cluster into distinct clades, with some showing species-specific duplications .

  • Standardized expression systems: Express the TAS2R43 variants from different primate species (human, Pan paniscus, Macaca mulatta, etc.) in the same cellular background to minimize variability from host cell factors.

  • Identical assay conditions: Use consistent methodologies for functional assays, including:

    • Same induction protocols (tetracycline concentration and timing)

    • Identical calcium indicator dyes and detection parameters

    • Consistent buffer compositions and temperatures

    • Same ligand concentration ranges (0.01-100 μM)

  • Controls for expression levels: Quantify receptor expression (via Western blot or flow cytometry) to normalize functional responses to expression levels.

  • Statistical analysis: Use appropriate statistical methods to compare EC50 values, maximum responses, and activation kinetics across species.

What methodologies are recommended for assessing TAS2R43 coupling to different G-protein subtypes?

To assess G-protein coupling specificity of TAS2R43:

  • G-protein chimeras: Utilize cells expressing different G-protein chimeras (e.g., Gα16gust44) that redirect signaling to calcium mobilization for easier detection .

  • BRET/FRET assays: Implement bioluminescence/fluorescence resonance energy transfer assays with tagged G-proteins and TAS2R43 to directly measure interaction.

  • G-protein selective inhibitors: Use pertussis toxin (PTX) to inhibit Gαi/o signaling or specific inhibitors for other G-protein subtypes to determine the predominant signaling pathway.

  • Downstream signaling analysis: Measure multiple downstream pathways (calcium flux, cAMP production, ERK phosphorylation) to create a comprehensive signaling profile.

  • Knockout/knockdown approaches: Generate cell lines with reduced expression of specific G-protein subunits to determine their contribution to TAS2R43 signaling.

How can researchers effectively correlate in vitro findings with sensory perception studies?

Bridging the gap between molecular studies and sensory perception requires:

  • Psychophysical testing: Design sensory studies with human volunteers to assess perceived bitterness of compounds that activate TAS2R43 in vitro.

  • Mixture effects analysis: Investigate how the sequence of consumption affects bitter perception. Research has shown that the order in which bitter compounds are consumed profoundly influences perceived bitterness .

  • Genetic association studies: Correlate TAS2R43 genetic variants in human populations with bitter taste perception phenotypes to validate in vitro findings.

  • Cross-modal interactions: Evaluate how TAS2R43 activation interacts with other taste modalities (sweet, umami) in complex food matrices.

  • Temporal analysis: Implement time-intensity methodologies to capture the dynamic nature of taste perception and compare with kinetic data from in vitro receptor activation studies.

What are the critical quality control parameters for recombinant TAS2R43 production?

Essential quality control parameters include:

  • Purity assessment: Verify protein purity (>90%) using SDS-PAGE and/or HPLC .

  • Identity confirmation: Confirm protein identity through:

    • Western blot with anti-His or anti-TAS2R43 antibodies

    • Mass spectrometry to verify molecular weight and sequence coverage

    • N-terminal sequencing to confirm proper translation start

  • Functional validation: Assess ligand-binding capability through:

    • Calcium mobilization assays with known agonists

    • Comparison with positive controls (aristolochic acid)

  • Storage stability monitoring: Evaluate receptor stability over time under recommended storage conditions (-20°C/-80°C with 6% trehalose) .

  • Lot-to-lot consistency: Implement quality management systems to ensure consistent production between batches.

How should researchers address potential artifacts in functional studies of TAS2R43?

To minimize artifacts in functional studies:

  • Include appropriate controls:

    • Non-induced cells (mock) to control for leaky expression

    • Empty vector controls to account for transfection effects

    • Positive control compounds (aristolochic acid for TAS2R43)

  • Account for compound solubility issues:

    • Verify compound solubility in assay buffers

    • Control for potential precipitation effects

    • Include vehicle controls (DMSO, ethanol) at matching concentrations

  • Minimize autofluorescence/quenching:

    • Test compounds for intrinsic fluorescence that might interfere with calcium indicators

    • Run parallel assays without cells to detect direct interactions between compounds and indicators

  • Control for non-specific effects:

    • Test compounds on parental cell lines lacking TAS2R43

    • Use selective antagonists (when available) to confirm receptor specificity

  • Address receptor desensitization:

    • Design protocols that account for potential receptor desensitization during repeated stimulation

    • Include sufficient wash-out periods between compound applications

How can understanding Pan paniscus TAS2R43 contribute to comparative evolutionary studies?

Research on Pan paniscus TAS2R43 offers valuable insights into bitter taste evolution:

  • Dietary adaptation markers: Comparative analysis of TAS2R43 across primates with different diets can reveal how taste receptor evolution correlates with ecological niches and food preferences .

  • Selection pressure analysis: Calculating dN/dS ratios (nonsynonymous to synonymous substitution rates) between human and Pan paniscus TAS2R43 can identify sites under positive selection, potentially indicating functional adaptation.

  • Structure-function relationship: Mapping species differences onto predicted receptor structures can identify critical domains governing ligand specificity.

  • Receptor repertoire complexity: Analysis of gene copy number variations across primates (27-51 total TAS2R genes) provides insight into how complex the bitter taste perception system needed to be for different ecological niches .

  • Convergent evolution assessment: Determining whether similar adaptive changes occurred independently in distantly related species facing similar dietary challenges.

What are emerging techniques for studying the dynamics of TAS2R43 activation?

Cutting-edge approaches for studying TAS2R43 dynamics include:

  • Cryo-electron microscopy: Recent advances in cryo-EM have enabled structural determination of GPCRs in different conformational states, potentially applicable to TAS2R43.

  • Single-molecule FRET: This technique can reveal conformational changes in real-time when TAS2R43 binds ligands, providing insights into activation mechanisms.

  • Molecular dynamics simulations: Computer modeling based on homology models can predict binding pockets and conformational changes upon ligand binding.

  • Nanobody-based sensors: Developing conformation-specific nanobodies that recognize active vs. inactive TAS2R43 states can enable real-time monitoring of receptor activation.

  • Optogenetic approaches: Engineering light-sensitive domains into TAS2R43 allows precise temporal control over receptor activity for studying downstream signaling kinetics.

How might research on TAS2R43 inform understanding of non-gustatory functions of bitter taste receptors?

Emerging research suggests broader roles for bitter taste receptors beyond taste perception:

  • Immune regulation: Investigating whether TAS2R43 is expressed in immune cells and how it might respond to bitter compounds or bacterial products.

  • Respiratory function: Determining if Pan paniscus TAS2R43 is expressed in airway cells and comparing its function to human TAS2R43, which has been implicated in bronchodilation.

  • Gastrointestinal roles: Exploring TAS2R43 expression in enteroendocrine cells and its potential role in regulating hormone secretion in response to bitter compounds.

  • Brain expression: Mapping TAS2R43 expression in neuronal tissues and investigating potential roles in neuronal signaling beyond taste perception.

  • Comparative extraoral expression: Analyzing whether extraoral expression patterns of TAS2R43 are conserved between humans and Pan paniscus, which could indicate functional importance beyond taste.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.