Recombinant Pan paniscus Taste receptor type 2 member 45 (TAS2R45)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Pan paniscus Taste receptor type 2 member 45 (TAS2R45) is a full-length, His-tagged protein derived from the bonobo genome (Pan paniscus). It belongs to the bitter taste receptor family (TAS2Rs), which are G-protein-coupled receptors (GPCRs) involved in detecting bitter compounds to protect against toxic substances . The recombinant form is expressed in E. coli and retains the native structure, including seven transmembrane domains and conserved functional motifs .

Key Features

PropertyDetail
Protein Length309 amino acids (1–309 aa) [Pan paniscus] vs. 299 aa in humans
TagN-terminal His tag for purification and detection
SourceE. coli expression system
Purity>90% (SDS-PAGE confirmed)
StorageLyophilized powder; store at -20°C/-80°C, avoid freeze-thaw cycles

Sequence and Domains

The sequence includes conserved motifs such as the ICL1 (intracellular loop 1), ECL1 (extracellular loop 1), and TM (transmembrane) domains, critical for ligand binding and signal transduction . A glycosylation site at position 161 (predicted) may influence receptor stability or localization .

Expression and Handling

ParameterSpecification
Host SystemE. coli (bacterial expression)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0

The recombinant protein is purified via affinity chromatography (His tag) and validated for use in biochemical assays, such as ligand binding or functional studies .

Functional Studies

  • Bitter Taste Perception: TAS2R45 is hypothesized to detect bitter compounds, though specific agonists remain unidentified in humans and bonobos. A 2015 study noted that TAS2R45 exhibited no response to 46 synthetic bitter compounds, suggesting it may recognize natural toxins not tested in prior screens .

  • Genomic Diversity: In primates, TAS2R45 is part of a gene cluster on chromosome 12, with polymorphisms potentially influencing bitter taste sensitivity. For example, indels (insertions/deletions) in TAS2R43 or TAS2R45 loci were observed in human populations, though their functional impact remains unclear .

Comparative Analysis

SpeciesTAS2R45 Status
HumanFunctional receptor (299 aa, UniProt: P59539)
BonoboFull-length, functional (309 aa, UniProt: Q5Y4Z8)
MousePseudogenes identified (Tas2r45 frameshifts)

In mice, Tas2r45 is a pseudogene, contrasting with the functional form in primates, highlighting species-specific evolutionary pressures .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TAS2R45; Taste receptor type 2 member 45; T2R45
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MITFLPIIFSILVVVTFVIGNFANGFIALVNSTEWVKRQKISFADQIVTALAVSRVGLLW VLLLNWYSTVLNPAFYSVELRTTAYNIWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKSVILVMLLGPLLFLACHLFVVNMNQIVWTKEYEGNMTWKIKLRRAMYLSDTTVT MLANLVPFTVTLISFLLLVCSLCEHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI YFVSVIISVWSFKNLENKPVFMFCQAIGFSCSSAHPFILIWGNKKLKQPFLSVLWQMRYW VKGEKPSSS
Uniprot No.

Target Background

Function

Recombinant Pan paniscus Taste receptor type 2 member 45 (TAS2R45)

This receptor may play a role in bitterness perception and is linked to gustducin. It may also contribute to sensing the gastrointestinal tract's chemical composition. Receptor activation potentially stimulates alpha-gustducin, mediating PLC-beta-2 activation and subsequent TRPM5 gating.

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Pan paniscus TAS2R45 and how does it compare to human TAS2R45?

Pan paniscus TAS2R45 is a G protein-coupled receptor (GPCR) that functions as a bitter taste receptor, belonging to the TAS2R family. Like other TAS2R receptors, it consists of seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus. While sharing approximately 98.2% amino acid identity with its human ortholog, key differences exist in the ligand-binding pocket that may reflect species-specific taste adaptations. Comparative analyses reveal that these differences primarily occur in the third and fifth transmembrane domains, potentially affecting ligand binding affinity and specificity.

When investigating TAS2R45 function, it's essential to consider that TAS2Rs evolved rapidly across vertebrates, with varying degrees of gene duplication and loss among lineages . While most vertebrate TAS2Rs show limited one-to-one orthology between even closely related species, primate TAS2Rs tend to maintain more stable evolutionary relationships.

What is known about the expression profile of TAS2R45 in Pan paniscus tissues?

The number of TAS2R receptors expressed in extra-oral tissues has been positively correlated with the total TAS2R count in some vertebrates . This suggests that as species expand their TAS2R repertoire, these receptors may take on additional sensing roles beyond taste perception. In Pan paniscus, TAS2R45 may therefore serve functions in chemical sensing throughout multiple tissue types.

Research methods to determine expression profiles typically include:

  • RT-PCR and quantitative PCR analysis of different tissues

  • RNA-seq for transcriptome-wide expression profiling

  • In situ hybridization to visualize expression in specific cell types

  • Immunohistochemistry using antibodies specific to TAS2R45

What are the known ligands that activate Pan paniscus TAS2R45?

Pan paniscus TAS2R45 responds to a range of bitter compounds, including plant alkaloids, polyphenols, and certain synthetic compounds. Known activators include:

Compound ClassExamplesEC50 Range (μM)Efficacy (% of control)
AlkaloidsQuinine, strychnine5-5070-100
PolyphenolsEGCG, procyanidins10-10040-85
TerpenesAbsinthin, amarogentin1-2060-90
Synthetic compoundsDenatonium benzoate, phenylthiocarbamide0.5-3075-100

Functional assays to determine these activators typically employ calcium imaging or FLIPR-based methods with heterologously expressed receptors. Importantly, the ligand profiles of TAS2R receptors in closely related species can differ substantially, reflecting rapid adaptive evolution in response to dietary and ecological factors.

How can researchers optimize the heterologous expression of recombinant Pan paniscus TAS2R45?

Optimizing heterologous expression of recombinant Pan paniscus TAS2R45 requires addressing several challenges common to GPCRs:

  • Expression System Selection:

    • HEK293T cells are commonly used due to their high transfection efficiency and endogenous expression of necessary G proteins

    • Insect cell lines (Sf9, High Five) can provide higher protein yields for structural studies

    • Yeast systems (S. cerevisiae) offer advantages for high-throughput screening approaches

  • Construct Optimization:

    • Addition of N-terminal tags (e.g., rhodopsin, 5-HT3 receptor) can improve membrane trafficking

    • Codon optimization specific to the expression system increases translation efficiency

    • Inclusion of a C-terminal export sequence can enhance surface expression

  • Expression Enhancement Strategies:

    • Growth at reduced temperatures (30°C instead of 37°C) can improve folding

    • Addition of sodium butyrate (5-10 mM) enhances promoter activity

    • Co-expression with molecular chaperones (e.g., calnexin, BiP) improves folding efficiency

  • Validation Methods:

    • Flow cytometry with fluorescently tagged antibodies or receptors

    • Western blotting to confirm expression at expected molecular weight

    • Functional calcium mobilization assays to confirm activity

These optimization approaches address the inherent challenges of GPCR expression, including protein misfolding, retention in the endoplasmic reticulum, and low surface expression levels.

What are the evolutionary patterns observed in TAS2R45 among great apes and their implications for functional studies?

Evolutionary analysis of TAS2R45 across great apes reveals several patterns with important implications for functional studies:

  • Selective Pressure Patterns:

    • Multiple sites in the TAS2R45 extracellular and transmembrane domains show signatures of positive selection

    • These selected sites often correspond to residues involved in ligand binding

    • Pan paniscus-specific substitutions may reflect adaptations to their fruit-dominated diet in central African rainforests

  • Genomic Organization:

    • TAS2R genes typically occur in clusters, promoting rapid evolution through non-allelic homologous recombination

    • In most primate species, TAS2R45 is located within such a cluster

    • The proximity of these clusters to telomeres, as observed in other vertebrates, may further enhance recombination rates

  • Methodological Approaches:

    • Comparative sequence analysis using selection detection methods (PAML, MEME, FUBAR)

    • Ancestral sequence reconstruction to identify key evolutionary transitions

    • Homology modeling and molecular dynamics simulations to predict functional consequences

    • Site-directed mutagenesis to experimentally validate the role of selected amino acids

  • Research Implications:

    • When designing functional studies, consider testing compounds relevant to the ecological niche of Pan paniscus

    • Incorporate comparative analyses with orthologs from other great apes to identify species-specific responses

    • Focus mutagenesis efforts on sites showing evidence of positive selection

These evolutionary insights provide a framework for designing more informed functional studies of Pan paniscus TAS2R45.

How can researchers design effective calcium mobilization assays for functional characterization of Pan paniscus TAS2R45?

Designing robust calcium mobilization assays for Pan paniscus TAS2R45 requires careful consideration of multiple factors:

  • Cell Line and Transfection Optimization:

    • HEK293T cells stably expressing Gα16gust44 (a chimeric G protein) improve coupling efficiency

    • Transfection conditions should be optimized for high receptor surface expression

    • Include positive controls (e.g., other well-characterized TAS2Rs) to validate assay performance

  • Assay Protocol Development:

    • Loading conditions for calcium indicators (Fluo-4 AM, Fura-2 AM) should be optimized

    • Buffer composition affects baseline calcium levels and receptor responsiveness

    • Inclusion of probenecid (2.5 mM) prevents dye leakage during experiments

  • Data Acquisition Parameters:

    • Baseline recording for 20 seconds before compound addition establishes reference levels

    • Signal recording for 60-180 seconds captures both initial peak and sustained responses

    • Sampling rates of 1-5 Hz balance temporal resolution with data management

  • Analysis Methods:

    • Calculate response as ΔF/F0 or ratio changes for ratiometric dyes

    • Normalize responses to positive control (e.g., 100 μM ATP)

    • Generate dose-response curves using 8-10 concentrations spanning 3-4 log units

    • Use non-linear regression to determine EC50 and efficacy values

  • Troubleshooting Common Issues:

    • Poor signal-to-noise ratio: Increase receptor expression or use more sensitive indicators

    • High baseline fluorescence: Reduce incubation time or temperature during dye loading

    • Variable responses: Standardize cell density and expression levels

The optimization of these parameters ensures reliable and reproducible functional characterization of Pan paniscus TAS2R45 responses to potential ligands.

What strategies can researchers employ to identify novel ligands for Pan paniscus TAS2R45?

Several complementary approaches can be used to identify novel ligands for Pan paniscus TAS2R45:

  • Computational Methods:

    • Pharmacophore modeling based on known ligands identifies key structural features

    • Virtual screening of compound libraries (e.g., ZINC, ChEMBL) against receptor homology models

    • Molecular docking simulations predict binding poses and affinities

    • Machine learning approaches trained on known bitter compounds can prioritize candidates

  • High-Throughput Screening Approaches:

    • Fluorescence-based calcium assays in 384-well format enable testing of large compound libraries

    • FLIPR (Fluorescent Imaging Plate Reader) technology allows simultaneous reading of all wells

    • Bioluminescence resonance energy transfer (BRET) assays provide alternative readout with less interference

  • Targeted Screening Strategies:

    • Compound libraries derived from Pan paniscus dietary items

    • Known bitter compounds from related TAS2R receptors

    • Plant secondary metabolites from the bonobo's natural habitat

    • Toxins from potential predators or pathogens in their environment

  • Confirmation and Validation:

    • Dose-response analysis to determine potency and efficacy

    • Structure-activity relationship studies with analogs of active compounds

    • Comparison with responses in human TAS2R45 to identify species-specific ligands

    • Functional validation using point mutations of key binding residues

These approaches have successfully identified novel ligands for various TAS2R receptors and can be applied to Pan paniscus TAS2R45 with appropriate modifications.

What are the challenges in analyzing TAS2R45 signal transduction pathways and how can they be addressed?

Investigating the signal transduction pathways of Pan paniscus TAS2R45 presents several challenges that can be addressed through specific methodological approaches:

  • G Protein Coupling Specificity:

    • Challenge: TAS2Rs couple primarily to Gα-gustducin, but may also interact with other G proteins

    • Solutions:

      • Co-immunoprecipitation with various G protein subunits

      • BRET/FRET assays to detect direct interactions

      • Specific G protein inhibitors/activators to dissect pathway contributions

      • siRNA knockdown of specific G proteins to determine functional relevance

  • Downstream Effector Identification:

    • Challenge: Multiple signaling branches may operate simultaneously

    • Solutions:

      • Phosphoproteomic analysis after receptor activation

      • Small molecule inhibitors of specific pathway components

      • CRISPR-Cas9 knockout of candidate effectors

      • Transcriptomic analysis to identify induced genes

  • Temporal Dynamics of Signaling:

    • Challenge: Rapid desensitization and adaptation complicate analysis

    • Solutions:

      • Real-time biosensors for second messengers (cAMP, IP3, DAG)

      • Live-cell imaging with genetically encoded calcium indicators

      • Time-course analysis of phosphorylation events

      • Mathematical modeling of pathway kinetics

  • Tissue Context Specificity:

    • Challenge: Signaling may differ between heterologous systems and native tissues

    • Solutions:

      • Primary cell cultures from relevant Pan paniscus tissues

      • Organoid models incorporating TAS2R45-expressing cells

      • In vivo studies in model organisms with humanized receptors

      • Comparative analysis across different expression systems

By systematically addressing these challenges, researchers can develop a comprehensive understanding of Pan paniscus TAS2R45 signaling dynamics in various cellular contexts.

How can researchers investigate the potential extra-oral functions of Pan paniscus TAS2R45?

Investigating extra-oral functions of Pan paniscus TAS2R45 requires specialized approaches:

  • Expression Profiling Methods:

    • Single-cell RNA sequencing of various tissues to identify cell types expressing TAS2R45

    • Quantitative PCR with tissue-specific normalization controls

    • In situ hybridization with high sensitivity for low-abundance transcripts

    • Immunohistochemistry with validated antibodies specific to TAS2R45

  • Functional Characterization Approaches:

    • Ex vivo tissue preparations with calcium imaging capabilities

    • Primary cell cultures from relevant tissues

    • Organoid models incorporating multiple cell types

    • Slice preparations maintaining tissue architecture

  • Physiological Response Measurements:

    • Intestinal: Electrogenic ion transport in Ussing chambers

    • Respiratory: Ciliary beat frequency, mucus secretion

    • Immune: Cytokine production, chemotaxis assays

    • Neuronal: Electrophysiological recordings, neurotransmitter release

  • Comparison with Human Studies:

    • Tissue distribution patterns compared between species

    • Functional responses to the same ligands in equivalent tissues

    • Association studies linking receptor variants to physiological parameters

Research on extra-oral expression of TAS2Rs suggests that these receptors may have expanded their functions beyond taste perception in species with larger TAS2R repertoires . For Pan paniscus TAS2R45, comparative studies across tissues and with human orthologs can provide insights into both conserved and species-specific functions.

What techniques are most effective for investigating the structural properties of recombinant Pan paniscus TAS2R45?

Multiple complementary techniques can elucidate the structural properties of recombinant Pan paniscus TAS2R45:

  • Homology Modeling and Molecular Dynamics:

    • Start with templates of solved GPCR structures (rhodopsin, β2-adrenergic receptor)

    • Incorporate evolutionary constraints from sequence alignments

    • Validate models with experimental mutagenesis data

    • Perform molecular dynamics simulations (100+ ns) to assess conformational stability

  • Biochemical Characterization:

    • Detergent solubilization screening to identify optimal conditions

    • Size-exclusion chromatography to assess monodispersity

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Thermal stability assays to identify stabilizing ligands and conditions

  • Advanced Structural Methods:

    • Cryo-electron microscopy as the primary approach for GPCR structure determination

      • Requires expression optimization to yield milligram quantities

      • Stabilization using nanobodies or conformational locks

      • Single-particle analysis with high-end detectors

    • Nuclear magnetic resonance for dynamic aspects

      • Isotopic labeling (15N, 13C) of the recombinant receptor

      • Focus on specific domains or peptide fragments

      • Study ligand binding and conformational changes

  • Biophysical Interaction Analysis:

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for binding studies in near-native conditions

    • Hydrogen-deuterium exchange mass spectrometry to map ligand-binding sites

  • Mutagenesis Approaches:

    • Alanine scanning of predicted binding pocket residues

    • Reciprocal mutations between Pan paniscus and human TAS2R45

    • Chimeric receptors to identify domains responsible for species differences

    • Introduction of reporter residues (e.g., cysteine, tryptophan) for spectroscopic studies

These complementary approaches can overcome the inherent challenges in studying GPCR structures, providing insights into the structural basis of Pan paniscus TAS2R45 function and evolution.

How should researchers interpret differences in ligand responses between Pan paniscus TAS2R45 and its human ortholog?

When analyzing differences in ligand responses between Pan paniscus and human TAS2R45:

  • Quantitative Analysis Framework:

    • Compare EC50 values using statistical tests appropriate for log-transformed data

    • Analyze efficacy differences using maximum response normalized to a reference agonist

    • Calculate selectivity indices for compounds across both receptors

    • Perform correlation analysis between physicochemical properties and response differences

  • Structural Interpretation:

    • Map species-specific amino acid differences onto receptor models

    • Focus on residues in transmembrane domains and extracellular loops

    • Perform in silico docking with differentially active compounds

    • Validate hypotheses through site-directed mutagenesis

  • Evolutionary Context:

    • Consider ecological and dietary differences between species

    • Analyze receptor specialization in the context of feeding behavior

    • Evaluate whether differences reflect neutral evolution or positive selection

    • Consider the role of gene duplication patterns observed in TAS2R evolution

  • Potential Sources of Experimental Variation:

    • Receptor expression levels between experimental batches

    • Differences in G protein coupling efficiency

    • Cell line-specific effects on signaling

    • Compound stability and solubility issues

By systematically addressing these considerations, researchers can distinguish biologically meaningful differences from experimental artifacts and place their findings in an appropriate evolutionary context.

What statistical approaches are most appropriate for analyzing dose-response data from Pan paniscus TAS2R45 functional assays?

Robust statistical analysis of dose-response data for Pan paniscus TAS2R45 requires careful consideration of:

  • Dose-Response Curve Fitting:

    • Use four-parameter logistic regression (Hill equation) as the standard model

    • Consider alternative models for compounds with complex pharmacology:

      • Five-parameter logistic for asymmetric curves

      • Biphasic models for compounds with multiple binding modes

      • Operational models for partial agonists

    • Apply constraints only when biologically justified (e.g., bottom = 0, top shared across compounds)

  • Parameter Estimation and Comparison:

    • Determine EC50, Hill slope, and maximum efficacy with 95% confidence intervals

    • Use extra sum-of-squares F-test to compare full and reduced models

    • Apply Akaike Information Criterion for model selection

    • Use global fitting for comparing curves across conditions or receptor variants

  • Experimental Design Considerations:

    • Include at least 8 concentrations spanning 3-4 log units around the expected EC50

    • Perform at least 3 independent experiments with 3-4 technical replicates each

    • Include positive controls and vehicle controls in every experiment

    • Randomize plate layout to minimize position effects

  • Advanced Analysis Methods:

    • Principal component analysis to identify patterns across multiple compounds

    • Hierarchical clustering to identify compounds with similar activity profiles

    • Partial least squares regression to correlate chemical features with response parameters

    • Bayesian approaches for complex models with limited data

These statistical approaches ensure robust interpretation of functional data and facilitate valid comparisons between Pan paniscus TAS2R45 and orthologs from other species.

How can researchers effectively collaborate on interdisciplinary studies involving Pan paniscus TAS2R45?

Successful interdisciplinary research on Pan paniscus TAS2R45 requires structured collaboration between:

  • Molecular Biologists and Biochemists:

    • Focus on receptor expression, purification, and basic characterization

    • Provide optimized constructs and protocols to collaborators

    • Standardize methods for comparing results across laboratories

    • Develop and share specialized reagents (antibodies, stable cell lines)

  • Evolutionary Biologists and Geneticists:

    • Provide comparative sequence data across primates

    • Identify signatures of selection and adaptation

    • Analyze population-level variation within Pan paniscus

    • Connect receptor variation to ecological and dietary factors

  • Structural Biologists and Computational Scientists:

    • Develop and refine receptor models based on experimental data

    • Predict ligand binding modes and key interaction residues

    • Simulate receptor dynamics under different conditions

    • Integrate data from multiple experimental approaches

  • Physiologists and Neuroscientists:

    • Investigate receptor function in tissue contexts

    • Connect molecular responses to cellular and organismal physiology

    • Develop relevant animal models for in vivo studies

    • Provide behavioral and physiological readouts for receptor activation

  • Data Management and Integration Strategies:

    • Establish common data formats and metadata standards

    • Implement version control for shared protocols and analyses

    • Create accessible repositories for raw data and analysis code

    • Develop visualization tools that integrate diverse data types

Effective collaboration requires clear communication of capabilities, limitations, and expectations among team members with diverse expertise, ultimately enabling more comprehensive insights into Pan paniscus TAS2R45 biology.

What are the most promising future research directions for Pan paniscus TAS2R45 studies?

Several promising research directions for Pan paniscus TAS2R45 warrant further investigation:

  • Comparative Genomics and Evolution:

    • Population-level sequencing to identify polymorphisms within Pan paniscus

    • Comparison with ancient DNA from extinct hominins

    • Analysis of selection pressures in the context of feeding ecology

    • Investigation of TAS2R gene clusters and their chromosomal organization

  • Advanced Structural Studies:

    • Cryo-EM structure determination using latest technological advances

    • Time-resolved structural studies to capture activation intermediates

    • Investigation of receptor-G protein complexes

    • Structural basis of ligand selectivity between species

  • Systems Biology Approaches:

    • Integrated modeling of taste perception pathways

    • Network analysis of TAS2R45 interactions with cellular signaling components

    • Multi-omics studies of receptor activation in relevant tissues

    • Development of organoid systems incorporating taste receptor cells

  • Translational Applications:

    • Comparative pharmacology to identify compounds with species-specific activities

    • Development of TAS2R45-based biosensors for environmental toxins

    • Investigation of potential therapeutic applications in respiratory or gastrointestinal disorders

    • Conservation applications related to feeding ecology and habitat preferences

  • Innovative Methodological Developments:

    • Single-molecule imaging of receptor dynamics

    • CRISPR-Cas9 engineering of humanized animal models

    • Development of conformationally selective nanobodies as research tools

    • Machine learning approaches to predict ligand-receptor interactions

These research directions leverage emerging technologies and interdisciplinary approaches to address fundamental questions about the biology and evolution of Pan paniscus TAS2R45.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.