Recombinant Pan paniscus Taste receptor type 2 member 46 (TAS2R46)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Pan paniscus Taste Receptor Type 2 Member 46 (TAS2R46) is a bioengineered protein derived from the bonobo (Pan paniscus), a close relative of humans. This protein belongs to the TAS2R family of bitter taste receptors, which are G protein-coupled receptors (GPCRs) involved in detecting bitter compounds to protect against toxins. Recombinant TAS2R46 is expressed in E. coli and purified for research purposes, enabling detailed studies of its structure, function, and ligand interactions.

3.1. Expression and Recombinant Design

  • Expression System: E. coli is the primary host for high-yield production, leveraging bacterial fermentation.

  • Tagging: The N-terminal His-tag facilitates affinity purification via nickel-chelating columns.

  • Reconstitution: Lyophilized protein is reconstituted in deionized water at 0.1–1.0 mg/mL, often with glycerol (5–50%) for stability .

3.2. Quality Control

  • SDS-PAGE: Confirms >90% purity.

  • Reconstitution Recommendations: Avoid repeated freeze-thaw cycles; store aliquots at -20°C/-80°C .

4.1. Ligand Binding and Activation

TAS2R46 recognizes diverse bitter compounds, including:

LigandRole
StrychnineStrong agonist; binds W88 and E265 residues .
AtropineClinically relevant antagonist (used in heart rate regulation) .
AbsinthinSesquiterpene lactone; modulates calcium dynamics in skeletal muscle .

Mechanism: Ligand binding induces conformational changes in TM3 and TM6, correlating with increased intra-protein dynamics and G protein signaling .

4.2. Extra-Oral Functions

  • Immune Modulation: TAS2R46 in monocytes regulates oxidative stress and differentiation, suggesting roles in inflammation .

  • Muscle Physiology: Reduces cytosolic calcium in human skeletal muscle via cAMP/EPAC pathways, potentially mitigating fatigue .

5.2. Molecular Dynamics (MD) Findings

  • Network Analysis: TM3 and TM6 exhibit high betweenness centrality in active states, driving signal propagation .

  • Y241 Rotation: Pivotal residue in TM6; its repositioning enables G protein coupling .

6.1. Therapeutic Targets

  • Inflammatory Bowel Disease (IBD): TAS2R46 variants linked to IBD pathogenesis .

  • Muscle Disorders: Potential target for sarcopenia or dystrophies via calcium regulation .

6.2. Comparative Evolutionary Studies

  • Primate Taste Perception: TAS2R46 homologs in bonobos and humans share ligand preferences, aiding evolutionary analysis .

References

  1. Creative Biomart. (2025). Recombinant Full Length Pan Paniscus Taste Receptor Type 2 Member 46 (TAS2R46) Protein, His-Tagged.

  2. Cusabio. (2025). TAS2R46 Proteins for Pan paniscus.

  3. Structural basis for strychnine activation of human bitter taste receptors. PubMed (2023).

  4. Molecular Biomechanics of the TAS2R46 Bitter Taste Receptor. BioRxiv (2023).

  5. GPCRdb. TAS2R46 (t2r46_human).

  6. TAS2R46. Wikipedia.

  7. Bitter Taste Receptor 46 (hTAS2R46) Protects Monocytes.... PMC (2024).

  8. BioRxiv. Molecular Biomechanics of TAS2R46 (2023).

  9. Sigma-Aldrich. TAS2R46.

  10. Bitter taste receptor (TAS2R) 46 in human skeletal muscle. Frontiers (2023).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R46; Taste receptor type 2 member 46; T2R46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MITFLPIIFSILIVVTFVIGNFANGFIALANSIEWFKRQKISFADQILTALAVSRVGLLW VLLLNWYATELNPAFYSIEVRITAYNLWAVINHFSNWLATSLSIFYLLKIANFSNLIFLR LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNITVT ILANLVPFTLTLISFLLLICSLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAI YFLSIIMSVWSFESLENKPVFMFCEAITFSYPSTHPFILIWGNKKLKQTFLSVLWHVRYW VKGEEPSSP
Uniprot No.

Target Background

Function
This receptor may play a role in perceiving bitterness and is linked to gustducin. It potentially contributes to sensing the chemical composition of gastrointestinal contents. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to TRPM5 gating. In airway epithelial cells, binding of bitter compounds increases intracellular calcium ion concentration and stimulates ciliary beat frequency.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane.

Q&A

What are the structural characteristics of Pan paniscus TAS2R46 and how do they compare to human TAS2R46?

Pan paniscus TAS2R46, like its human ortholog, belongs to the GPCR superfamily but displays distinctive structural features that differentiate it from classical class A GPCRs. The receptor contains seven transmembrane (TM) domains with unique conserved motifs. Unlike class A GPCRs that have the conserved DRY motif in TM3, CWxP in TM6, and NPxxY motif in TM7, TAS2R46 contains substituted motifs: a highly preserved FYxxK motif instead of DRY, and HSxxL replacing NPxxY . Additionally, TAS2R46 possesses unique conserved motifs, such as the TM1-2-7 interaction pattern, which differs from the highly conserved N1.50-D2.50-N7.49 pattern in class A GPCRs .

The TM similarity between TAS2Rs and typical GPCRs is lower than 30%, highlighting their structural uniqueness . Recent cryo-electron microscopy has revealed the three-dimensional structure of human TAS2R46 in both strychnine-bound and apo states, providing valuable templates for comparative modeling of the Pan paniscus variant .

What are the primary ligands known to activate TAS2R46 and how is activation measured experimentally?

The primary known agonists for TAS2R46 include:

  • Strychnine: A toxic bitter alkaloid that serves as one of the main agonists that activate the TAS2R46-G-protein pathway .

  • Absinthin: A highly specific agonist for TAS2R46 that has been shown to induce responses in cells expressing this receptor .

Activation of TAS2R46 can be measured through several experimental approaches:

  • Calcium mobilization assays: Since TAS2R46 activation triggers calcium release, fluorescent calcium indicators can measure receptor activation .

  • Phospholipase C activity measurement: As TAS2R46 signals through G proteins that activate phospholipase C .

  • Conformational change analysis: Using molecular dynamics simulations to track structural changes upon ligand binding .

  • Allosteric network analysis: Assessing the communication pathways between extracellular and intracellular domains upon activation .

What expression systems are most effective for producing recombinant Pan paniscus TAS2R46?

While the search results don't specifically address expression systems for Pan paniscus TAS2R46, the following approaches have proven effective for recombinant bitter taste receptors:

  • Mammalian cell lines: HEK293 cells are commonly used due to their proper protein folding machinery and post-translational modification capabilities essential for GPCR functionality.

  • Insect cell expression systems: Sf9 or High Five insect cells coupled with baculovirus expression vectors offer high yield while maintaining proper protein folding.

  • Yeast expression systems: Pichia pastoris or Saccharomyces cerevisiae can be used for large-scale production, though glycosylation patterns differ from mammalian systems.

For optimal expression, researchers should consider:

  • Adding N-terminal signal peptides to enhance membrane trafficking

  • Including purification tags (His, FLAG, etc.) that minimally impact receptor function

  • Codon optimization for the selected expression system

  • Temperature optimization during expression (typically lower temperatures improve proper folding)

  • Addition of molecular chaperones to enhance correct folding

How can molecular dynamics simulations be optimally designed to investigate Pan paniscus TAS2R46 conformational changes?

Molecular dynamics (MD) simulations provide valuable insights into TAS2R46 conformational dynamics and activation mechanisms. Based on recent research methodologies, an optimal simulation approach should include:

  • System preparation:

    • Embed the receptor in a phospholipid bilayer (typically POPC) to mimic the cellular membrane environment

    • Solvate with explicit water molecules and add physiological ion concentrations

    • Include bound ligand for holo state simulations or remove for apo state investigations

  • Simulation parameters:

    • Use established force fields like CHARMM36 or AMBER for proteins and lipids

    • Implement multiple replicas (at least 3) with different initial velocities to ensure statistical significance

    • Maintain constant temperature (303-310K) and pressure (1 atm) using appropriate thermostats and barostats

    • Set integration time steps of 2 fs with constraint algorithms for bonds involving hydrogen atoms

  • Simulation length:

    • Run equilibration for at least 100 ns to achieve structural stability

    • Extend production runs to at least 400 ns per replica to capture relevant conformational changes

    • Consider concatenating trajectories for a total sampling of >1 μs

  • Analysis metrics:

    • RMSD (Root Mean Square Deviation) to assess structural stability

    • RMSF (Root Mean Square Fluctuation) to identify flexible regions

    • Cluster analysis to identify predominant conformational states

    • Secondary structure analysis to monitor stability of transmembrane domains

    • Volume calculations of the binding pocket to correlate with activation state

    • Angle measurements between specific residues (e.g., angle θ between Y241 aromatic ring center, Y241 alpha carbon, and Y271 alpha carbon)

What techniques are most effective for analyzing allosteric networks in TAS2R46?

Analysis of allosteric networks in TAS2R46 requires sophisticated computational approaches to characterize the communication pathways between different receptor regions. Based on current research, the following techniques are most effective:

Analysis results indicate that in the presence of strychnine (holo state), TAS2R46 exhibits more correlated dynamics with signal transduction occurring via both TM3 and TM6. In contrast, in the apo state, TM3 assumes a primary role in information transfer, with decreased involvement of TM6 .

How should binding assays be designed to accurately determine ligand affinity and specificity for Pan paniscus TAS2R46?

Designing robust binding assays for TAS2R46 requires careful consideration of receptor properties and ligand characteristics. An optimal experimental design should include:

  • Direct binding assays:

    • Radioligand binding using tritiated or iodinated ligands

    • Fluorescence-based binding assays with fluorescently labeled ligands

    • Surface plasmon resonance (SPR) with immobilized receptor or ligand

    • Microscale thermophoresis (MST) to detect binding-induced changes in thermophoretic mobility

  • Functional response assays:

    • Calcium mobilization assays using fluorescent calcium indicators

    • BRET/FRET-based assays to monitor conformational changes or protein interactions

    • G-protein activation assays measuring GTPγS binding or cAMP production

    • β-arrestin recruitment assays for monitoring receptor desensitization

  • Experimental considerations:

    • Use appropriate positive controls (known agonists like strychnine or absinthin)

    • Include negative controls (non-binding compounds or inactive receptor mutants)

    • Perform displacement assays with unlabeled compounds to determine competitive binding

    • Test concentration ranges spanning at least 3-4 orders of magnitude

    • Establish complete concentration-response curves for accurate EC50/IC50 determination

    • Account for potential allosteric interactions between binding sites

  • Data analysis:

    • Apply appropriate binding models (one-site, two-site, cooperative)

    • Calculate binding parameters (Kd, Bmax, Ki) using nonlinear regression

    • Determine functional parameters (EC50, Emax) from dose-response curves

    • Assess biased signaling by comparing responses across different pathways

    • Consider residence time (association/dissociation kinetics) for complete binding characterization

How do the allosteric networks of Pan paniscus TAS2R46 differ between agonist-bound and unbound states?

The conformational dynamics and allosteric networks of TAS2R46 undergo significant changes between agonist-bound (holo) and unbound (apo) states, reflecting the receptor's activation mechanism. Based on molecular dynamics studies of human TAS2R46, which would share high homology with Pan paniscus TAS2R46, the following key differences have been observed:

These findings suggest that agonist binding to Pan paniscus TAS2R46 would induce a more coordinated receptor state with enhanced communication between the ligand-binding pocket and the G-protein coupling interface, primarily mediated through an allosteric network involving both TM3 and TM6.

What are the key molecular determinants that differentiate Pan paniscus TAS2R46 activation from class A GPCR activation mechanisms?

TAS2R46 follows a distinct activation mechanism compared to classical class A GPCRs, highlighting the unique evolutionary adaptations of bitter taste receptors. Key molecular determinants that differentiate TAS2R46 activation include:

These molecular determinants highlight the unique evolutionary pathway of TAS2Rs and explain why traditional GPCR targeting approaches may not be directly applicable to these receptors, necessitating specialized experimental designs for studying Pan paniscus TAS2R46.

How do post-translational modifications affect Pan paniscus TAS2R46 function and pharmacology?

Post-translational modifications (PTMs) play crucial roles in regulating GPCR function, and although specific data on Pan paniscus TAS2R46 PTMs are not provided in the search results, we can infer likely mechanisms based on knowledge of GPCR biology and available TAS2R research:

  • Glycosylation:

    • N-linked glycosylation sites in the N-terminus and extracellular loops likely influence receptor trafficking to the plasma membrane

    • Glycosylation patterns may affect ligand recognition by altering the extracellular receptor surface

    • Different glycosylation patterns between recombinant systems and native tissues could explain functional variations in experimental settings

  • Phosphorylation:

    • Ser/Thr/Tyr phosphorylation in intracellular loops and the C-terminus regulates receptor desensitization and internalization

    • Kinase-specific phosphorylation patterns may create barcode-like signatures that recruit different downstream effectors

    • Phosphorylation status likely influences the receptor's coupling preference to different G-protein subtypes or β-arrestins

  • Palmitoylation:

    • Cysteine palmitoylation in the C-terminal region creates membrane anchors that affect receptor stability

    • Dynamic palmitoylation/depalmitoylation cycles may regulate receptor localization in membrane microdomains

    • Altered palmitoylation could affect TAS2R46 association with other membrane proteins or signaling complexes

  • Ubiquitination:

    • Lysine ubiquitination targets receptors for degradation, controlling receptor turnover rates

    • Different ubiquitination patterns may direct receptors to lysosomal or proteasomal degradation pathways

    • Deubiquitinating enzymes provide an additional regulatory layer for fine-tuning receptor levels

  • Disulfide bond formation:

    • Conserved disulfide bonds between extracellular loops stabilize receptor conformation

    • Altered redox conditions could affect disulfide bond integrity and consequently impact ligand binding properties

  • Methodological considerations for studying PTMs:

    • Mass spectrometry approaches for identifying and quantifying specific PTMs

    • Site-directed mutagenesis of potential PTM sites to assess functional impact

    • Comparison of PTM patterns between native tissue receptors and recombinant expression systems

    • Use of inhibitors targeting specific PTM enzymes to evaluate dynamic regulation

How should researchers reconcile contradictory findings between molecular dynamics simulations and experimental data for TAS2R46?

When faced with discrepancies between computational predictions and experimental observations for TAS2R46, researchers should implement a systematic approach to reconcile these contradictions:

  • Assessment of computational model limitations:

    • Evaluate force field accuracy for membrane proteins and ligand parameters

    • Consider simulation time limitations that may prevent sampling of all relevant conformational states

    • Assess whether appropriate protonation states were used for titratable residues

    • Examine boundary conditions and membrane composition effects on receptor behavior

    • Verify that water models adequately represent solvation effects around the receptor

  • Critical analysis of experimental conditions:

    • Consider the impact of expression systems on receptor folding, PTMs, and function

    • Evaluate the influence of fusion tags or reporter systems on receptor conformational dynamics

    • Assess experimental temperature, pH, and buffer conditions versus simulation parameters

    • Consider the temporal resolution of experimental techniques versus simulation timescales

    • Analyze potential artifacts introduced by receptor purification or reconstitution processes

  • Reconciliation strategies:

    • Implement enhanced sampling techniques (metadynamics, replica exchange) to overcome energy barriers not accessible in standard MD

    • Design targeted experiments to specifically test computational predictions

    • Use intermediate resolution approaches (HDX-MS, EPR, FRET) to bridge atomistic simulations and macroscopic functional assays

    • Apply ensemble-based approaches that consider multiple receptor conformations rather than single states

    • Develop hybrid models that integrate both computational predictions and experimental constraints

  • Data integration table:

Data SourceObservationPotential LimitationReconciliation Approach
MD SimulationPredicts specific residues for allosteric communicationLimited sampling, force field biasExtend simulation time, use multiple force fields
MutagenesisMutation of predicted key residue shows no effectCompensatory mechanisms in proteinTest double/triple mutations, analyze indirect effects
Binding StudiesDifferent binding mode than predictedCrystal structure artifactsImplement flexible docking, consider multiple poses
Activation AssaysLower/higher efficacy than predictedAssay-specific biasesTest multiple orthogonal assays, analyze biased signaling
Structural DataDifferent conformation than simulationCrystal packing effectsCompare multiple structures, use NMR or cryo-EM constraints
  • Iterative refinement process:

    • Use experimental data to refine computational models

    • Design new simulations based on experimental insights

    • Generate testable predictions from refined models

    • Validate with additional experimental approaches

    • Document both agreements and persistent discrepancies transparently

What statistical approaches are most appropriate for analyzing TAS2R46 allosteric network data?

Analyzing allosteric network data for TAS2R46 requires sophisticated statistical approaches to identify significant patterns, quantify differences between receptor states, and ensure reproducibility. The following statistical methodologies are recommended:

  • Correlation analysis validation:

    • Bootstrap resampling to establish confidence intervals for correlation coefficients

    • Permutation tests to determine statistical significance of observed correlations

    • Cross-validation by splitting trajectories and comparing correlation patterns

    • Calculation of effect sizes to quantify the magnitude of differences between states

  • Network metrics comparison:

    • Non-parametric tests (Mann-Whitney U, Kruskal-Wallis) for comparing betweenness centrality distributions across different receptor states

    • ANOVA with post-hoc tests for comparing eigenvector centrality between specific residues or domains

    • Graph-theoretic metrics like clustering coefficients and path lengths to characterize network properties

    • Permutation-based significance testing for community structure differences

  • Multivariate analysis:

    • Principal Component Analysis (PCA) to identify main modes of receptor conformational dynamics

    • Partial Least Squares (PLS) analysis to correlate structural changes with functional outcomes

    • Independent Component Analysis (ICA) to separate statistically independent motion patterns

    • Time-lagged Independent Component Analysis (TICA) to identify slow dynamical processes

  • Time series analysis:

    • Autocorrelation functions to determine characteristic timescales of motions

    • Wavelet analysis to identify time-dependent patterns in receptor dynamics

    • Hidden Markov Models (HMMs) to identify discrete conformational states and transition probabilities

    • Transition Path Theory (TPT) analyses to characterize pathways between identified states

  • Multiple testing correction:

    • False Discovery Rate (FDR) control using Benjamini-Hochberg procedure

    • Family-wise error rate control using Bonferroni or Holm-Bonferroni methods

    • Significance threshold adjustment based on effective degrees of freedom in correlated data

  • Data visualization strategies:

    • Network representations with node size/color representing statistical significance

    • Heat maps with hierarchical clustering to identify patterns in correlation matrices

    • Difference maps highlighting statistically significant changes between receptor states

    • 3D structural mapping of significance values for intuitive interpretation

These statistical approaches should be combined with appropriate sensitivity analyses to ensure robustness of findings across different parameter choices, simulation conditions, and analysis methodologies.

How can researchers effectively compare Pan paniscus TAS2R46 with orthologs from other species to identify evolutionary conserved functional mechanisms?

Comparative analysis of TAS2R46 across species provides valuable insights into evolutionary conservation and divergence of bitter taste receptor function. Researchers can implement the following comprehensive approach to identify conserved functional mechanisms:

  • Sequence-based comparative analysis:

    • Multiple sequence alignment of TAS2R46 orthologs across primates and other mammals

    • Calculation of conservation scores (e.g., ConSurf, Evolutionary Trace) to identify functionally important residues

    • Positive selection analysis to detect sites under adaptive evolution

    • Coevolution analysis to identify co-varying residue networks potentially involved in allosteric communication

    • Ancestral sequence reconstruction to trace evolutionary changes

  • Structural comparison methodologies:

    • Homology modeling of orthologs based on human TAS2R46 structure

    • Superimposition analysis to identify structural divergence in key functional regions

    • Binding pocket comparison to assess ligand specificity determinants

    • Analysis of surface electrostatic properties to identify species-specific interaction interfaces

    • Comparison of predicted dynamic properties through normal mode analysis or short MD simulations

  • Functional conservation assessment:

    • Pharmacological profiling of orthologs with a panel of bitter compounds

    • Comparison of dose-response curves to identify differences in efficacy and potency

    • Analysis of G-protein coupling preferences across species

    • Evaluation of receptor internalization and desensitization kinetics

    • Creation of chimeric receptors to map species-specific functional domains

  • Systematic data organization:

SpeciesSequence Identity (%)Key Divergent ResiduesFunctional DifferencesProposed Evolutionary Pressure
Human100 (reference)---
Pan paniscus~99e.g., position X, Y, ZPotentially altered affinity for plant alkaloidsDietary adaptation
Pan troglodytes~98e.g., position A, B, CSimilar to humanShared environmental pressures
Gorilla gorilla~95e.g., position D, E, FPotentially reduced response to certain bitter compoundsDifferent plant diet
Macaca mulatta~90Multiple variationsDifferent pharmacological profileDivergent dietary evolution
Mus musculus~75Substantial differencesSignificantly altered ligand specificityRodent-specific dietary adaptation
  • Integrative evolutionary analysis:

    • Correlation between genetic distances and functional differences

    • Mapping of sequence variations to 3D structure and allosteric networks

    • Ecological and dietary correlation analysis to explain functional divergence

    • Molecular clock analysis to date key evolutionary changes

    • Comparative gene expression analysis across tissues to identify divergent expression patterns

This comprehensive approach enables researchers to distinguish between highly conserved functional mechanisms that are fundamental to TAS2R46 function across species and lineage-specific adaptations that reflect ecological and dietary specializations.

What emerging technologies could advance our understanding of Pan paniscus TAS2R46 structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of TAS2R46 structure-function relationships:

  • Advanced structural biology approaches:

    • Time-resolved cryo-electron microscopy (cryo-EM) to capture dynamic conformational changes during receptor activation

    • Serial femtosecond crystallography using X-ray free-electron lasers (XFEL) for room-temperature structural studies without radiation damage

    • Solid-state NMR spectroscopy to analyze dynamics in membrane-embedded receptors

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes with peptide-level resolution

    • Single-particle cryo-electron tomography for in situ structural studies in native membrane environments

  • Advanced computational approaches:

    • Machine learning-enhanced molecular dynamics to extend simulation timescales to milliseconds

    • Quantum mechanics/molecular mechanics (QM/MM) simulations for accurate modeling of ligand-receptor interactions

    • Markov State Models (MSMs) to map complete conformational landscapes and transition pathways

    • Graph neural networks for improved prediction of allosteric communication pathways

    • Artificial intelligence approaches for predicting ligand specificity across species variants

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational dynamics in real-time

    • Force spectroscopy to measure mechanical properties of receptor activation

    • Fluorescence correlation spectroscopy to analyze receptor diffusion and oligomerization

    • Single-cell receptor trafficking imaging to monitor receptor life cycle

  • Genetic and functional genomic approaches:

    • CRISPR/Cas9 genome editing to create precise mutations in endogenous receptor genes

    • Single-cell transcriptomics to map receptor expression across diverse cell populations

    • Spatial transcriptomics to analyze receptor distribution in native tissues

    • Comparative genomics across primate species to link genetic differences to functional variations

  • Systems biology integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics

    • Mathematical modeling of receptor signaling networks across different cell types

    • High-content screening of cellular responses to diverse bitter compounds

    • Organ-on-chip technologies for physiologically relevant functional studies

These emerging technologies will enable more comprehensive and physiologically relevant studies of TAS2R46, moving beyond isolated receptor systems to understand its function in complex cellular and tissue environments.

How might researchers investigate the potential extra-oral functions of Pan paniscus TAS2R46 in a systematic manner?

The discovery of taste receptors in extra-oral tissues has opened new research avenues regarding their non-gustatory functions. A systematic investigation of Pan paniscus TAS2R46 extra-oral functions should incorporate:

  • Comprehensive expression mapping:

    • RNAseq and proteomics analysis across diverse tissue and cell types

    • Single-cell transcriptomics to identify specific cell populations expressing TAS2R46

    • Comparative expression analysis between humans and bonobos to identify conserved expression patterns

    • Development of specific antibodies or reporter systems for protein-level detection

    • Spatial transcriptomics to determine precise localization within complex tissues

  • Physiological function assessment:

    • Airway smooth muscle studies: Given that TAS2R46 is expressed in human airway smooth muscle and mediates relaxation, similar studies in bonobo cells could reveal conserved bronchodilatory functions

    • Gastrointestinal function: Investigation of TAS2R46 role in gut hormone secretion, motility, and nutrient sensing

    • Immune cell function: Analysis of receptor's role in inflammatory responses and chemotaxis

    • Neuroendocrine functions: Study of potential roles in hormone secretion and regulation

    • Cardiovascular effects: Assessment of vasodilation/constriction and cardiac functions

  • Signaling pathway characterization:

    • G protein coupling specificity in different cell types

    • Calcium mobilization patterns across diverse extra-oral cells

    • cAMP/PKA pathway activation or inhibition

    • MAP kinase cascade involvement

    • β-arrestin recruitment and signaling bias in different tissues

  • Experimental approaches table:

Tissue SystemKey Research QuestionsMethodological ApproachesPotential Functional Significance
RespiratoryDoes TAS2R46 activation cause bronchodilation?Ex vivo airway tissue mechanics, calcium imaging in isolated smooth muscle cellsEvolutionary adaptation to airborne irritants
GastrointestinalDoes TAS2R46 mediate bitter taste-induced hormone release?Gut hormone assays, electrophysiology, organoid studiesRegulation of appetite and digestion
ImmuneDoes TAS2R46 modulate inflammatory responses?Cytokine profiling, migration assays, phagocytosis studiesDefense against potentially harmful compounds
CardiovascularDoes TAS2R46 influence vascular tone?Wire myography, blood pressure measurements, cardiac function testsRegulation of cardiovascular responses to dietary compounds
NeurologicalIs TAS2R46 involved in neuromodulation?Electrophysiology, neurotransmitter release assaysSensory integration beyond taste
  • Comparative evolutionary approach:

    • Cross-species functional comparison to identify conserved extra-oral roles

    • Analysis of selection pressure on receptor sequence in oral versus extra-oral tissues

    • Investigation of receptor polymorphisms associated with physiological phenotypes

    • Correlation between dietary adaptations and extra-oral receptor functions

    • Development of evolutionary models explaining the maintenance of extra-oral expression

This systematic approach would not only characterize the functions of Pan paniscus TAS2R46 in different physiological systems but also provide insights into the evolutionary significance of taste receptor expression beyond the gustatory system.

What computational approaches could predict novel agonists or antagonists specific for Pan paniscus TAS2R46?

Computational drug discovery approaches offer powerful tools for identifying novel TAS2R46 modulators. A comprehensive strategy should include:

  • Structure-based virtual screening:

    • Homology modeling of Pan paniscus TAS2R46 based on human TAS2R46 cryo-EM structure

    • Molecular docking of large compound libraries targeting the orthosteric binding site

    • Ensemble docking using multiple receptor conformations from MD simulations

    • Fragment-based approaches to design novel chemotypes with optimal receptor interactions

    • Identification of allosteric binding sites beyond the orthosteric pocket using computational solvent mapping

  • Ligand-based approaches:

    • Pharmacophore modeling based on known agonists like strychnine and absinthin

    • Quantitative structure-activity relationship (QSAR) development

    • Similarity searching and bioisostere replacement

    • Machine learning models trained on known bitter compounds

    • 3D shape-based virtual screening using known active molecules as templates

  • Advanced simulation techniques:

    • Free energy perturbation (FEP) calculations to accurately predict binding affinities

    • Metadynamics simulations to map binding/unbinding pathways and energy landscapes

    • Markov state modeling to identify intermediate binding states

    • Network analysis to identify allosteric modulation opportunities

    • Molecular interaction fingerprints to characterize binding modes

  • Integrated artificial intelligence approaches:

    • Deep learning models for activity prediction

    • Generative models (VAEs, GANs) for de novo compound design

    • Reinforcement learning for multi-parameter optimization

    • Graph neural networks for predicting protein-ligand interactions

    • Transfer learning leveraging data from related bitter taste receptors

  • Systematic evaluation workflow:

Computational StageMethodologiesExpected OutcomesValidation Approach
Target PreparationHomology modeling, MD refinement, binding site analysisAccurate receptor model with characterized binding pocketsRetrospective docking of known ligands
Virtual ScreeningDocking, pharmacophore screening, shape-based searchingRanked list of potential hits from diverse chemical librariesClustering for chemical diversity analysis
Hit RefinementFEP calculations, fragment growing, scaffold hoppingOptimized compounds with improved predicted affinityMM-GBSA calculations, interaction analysis
Selectivity AnalysisCross-docking to related receptors, selectivity fingerprintsCompounds with predicted selectivity for Pan paniscus TAS2R46Sequence-based selectivity analysis
De Novo DesignGenerative models, fragment linking, evolutionary algorithmsNovel chemical entities beyond known chemical spaceSynthetic accessibility assessment
  • Specialized considerations for bitter taste receptors:

    • Incorporation of known bitter taste molecular features (bitter taste descriptors)

    • Analysis of natural product databases due to the evolutionary role of TAS2Rs in detecting plant toxins

    • Focus on compounds with favorable physicochemical properties for oral bioavailability

    • Consideration of species-specific variations in the binding pocket between human and Pan paniscus TAS2R46

    • Prediction of potential signaling bias (G-protein vs. β-arrestin pathways)

This comprehensive computational strategy would efficiently identify novel chemical entities as tools for investigating Pan paniscus TAS2R46 structure, function, and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.