Recombinant Pan paniscus Taste receptor type 2 member 60 (TAS2R60)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pan paniscus Taste Receptor Type 2 Member 60 (TAS2R60)

Recombinant Pan paniscus TAS2R60 is a genetically engineered protein derived from the bitter taste receptor gene family (TAS2Rs) of the bonobo (Pan paniscus). As a G protein-coupled receptor (GPCR), it plays a role in detecting bitter compounds, a defense mechanism against toxins. This recombinant variant enables biochemical and pharmacological studies without requiring native tissue extraction .

Basic Information

PropertyDetail
Protein NameTaste receptor type 2 member 60
Gene NameTAS2R60
OrganismPan paniscus (Bonobo)
UniProt IDP59551 (Human ortholog)
Molecular Weight~36 kDa
Amino Acid Length318
Transmembrane Domains7

TAS2R60 shares structural homology with human TAS2R60, including conserved intracellular domains and a seven-transmembrane architecture typical of GPCRs .

Key Domains

  • N-terminal: Short extracellular domain involved in ligand recognition.

  • Transmembrane helices: Critical for signal transduction, particularly TM3, TM5, and TM6 .

  • Intracellular loops: Mediate G-protein coupling (e.g., ICL2 and ICL3) .

Functional assays reveal TAS2R60's activation by bitter compounds like phenylthiocarbamide (PTC) and its role in extraoral tissues, such as the respiratory and digestive systems .

In Vitro and Therapeutic Studies

  • Ligand Screening: Used to identify bitter compounds for drug development .

  • Extraoral Function Studies: Investigates roles in immune response, smooth muscle contraction, and metabolic regulation .

  • Evolutionary Analysis: Comparative studies with amphibian TAS2Rs highlight rapid gene duplication and functional diversification .

Key Studies

  1. Extraoral Expression: TAS2R60 is detected in human bronchial epithelial cells, suggesting a role in pathogen defense via bitter compound detection .

  2. Polymorphism Impact: Genetic variations in TAS2R60 correlate with altered bitter perception and disease susceptibility (e.g., respiratory infections) .

  3. Amphibian Orthologs: Comparative genomics reveals TAS2R expansion in amphibians, driven by tandem duplication and telomere-proximal clustering .

Future Directions

Recombinant TAS2R60 is pivotal for:

  • Developing bitter blockers to improve drug palatability.

  • Exploring GPCR signaling pathways in non-taste tissues.

  • Evolutionary studies on sensory receptor adaptation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of your specified tag.
Synonyms
TAS2R60; Taste receptor type 2 member 60; T2R60; T2R56
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLV SLGASHFCLQSVVMGKTIYVFLYPMAFPYNPVLQFLAFQWDFLNAATLWFSTWLSVFYCV KIATFTHPVFFWLKHKLSGWLPWMIFSYVGLSSFTTILFFIGNHRMYQNYLKNHLQPWNV TGNSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHMKKALLTTSGFREPSVQ AHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSN CRLRAVLKSRRSSRCGTP
Uniprot No.

Target Background

Function
This receptor plays a potential role in bitter taste perception and is linked to gustducin. It may also contribute to sensing the chemical composition of the gastrointestinal contents. The receptor's activity may stimulate alpha gustducin, mediate PLC-beta-2 activation, and ultimately lead to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Pan paniscus TAS2R60 and how does it compare to the human ortholog?

Similar to human TAS2R60, the Pan paniscus TAS2R60 is a G-protein coupled receptor (GPCR) belonging to the bitter taste receptor family. The protein features a characteristic 7-transmembrane structure with conserved short N- and C-terminal domains . The human ortholog comprises 318 amino acids with a predicted molecular weight of 36 kDa . While specific Pan paniscus sequence data is not comprehensively documented in the provided sources, evolutionary conservation patterns suggest high sequence similarity between human and bonobo TAS2R60, particularly in the intracellular domains which are significantly conserved across TAS2R family members . For experimental work, researchers should note that TAS2R60 contains multiple transmembrane regions that present challenges for expression and purification protocols, requiring specialized approaches for recombinant production.

Which expression systems are most suitable for recombinant Pan paniscus TAS2R60 production?

When expressing recombinant Pan paniscus TAS2R60, mammalian expression systems typically yield optimal results for functional studies. The AD-293 or 293AD cell lines have demonstrated strong adherent properties that facilitate media changes during assay procedures . These cell lines offer distinct advantages for bitter taste receptor expression, though empirical evaluation is necessary as expression capacity varies between cell lines due to multiple factors . For functional expression, researchers should consider:

  • Incorporating signal sequences to enhance cell surface trafficking

  • Co-expressing chimeric G proteins (such as Gα16-gust44) to facilitate coupling

  • Including accessory proteins that may improve receptor trafficking

The selection between eukaryotic expression systems should be empirically determined, as some TAS2Rs show variable expression efficiency across different cell backgrounds .

How can researchers optimize cell surface expression of recombinant TAS2R60?

Optimizing cell surface expression of recombinant TAS2R60 requires strategic modifications to overcome inherent trafficking limitations. Several approaches have proven effective:

Signal Sequence StrategyEffect on Surface ExpressionImplementation Complexity
SST3 signal sequenceModerate improvementStandard methodology
Rhodopsin (Rho) signal sequenceModerate improvementStandard methodology
M3 receptor signal sequenceHigher magnitude response for some TAS2RsRequires optimization
Co-expression with RTP/REEP proteinsVariable effectsReceptor-dependent

The introduction of export tags from other GPCRs significantly enhances functional receptor expression at the plasma membrane . Notably, some bitter taste receptors (including TAS2R20, TAS2R38, and TAS2R50) exhibited substantially improved functional readouts when tagged with the M3 receptor signal sequence compared to the commonly used SST3 tag . This effect may relate to the introduction of additional N-glycosylation sites, which can enhance receptor folding and trafficking. For Pan paniscus TAS2R60, researchers should empirically determine the optimal signal sequence, as the effectiveness may vary based on receptor-specific structural features .

What functional assays are most reliable for characterizing recombinant Pan paniscus TAS2R60?

For functional characterization of recombinant Pan paniscus TAS2R60, bioluminescence-based assays offer significant advantages over fluorescence-based methods, particularly when working with plant extracts or complex biological samples. When implementing functional assays:

A bioluminescence-based intracellular calcium release assay using calcium-sensitive photoproteins (such as aequorin or clytin) provides robust measurement of receptor activation while avoiding interference from autofluorescent compounds present in natural samples . This approach requires:

  • Co-expression of the receptor with a chimeric G protein (Gα16-gust44) to ensure coupling to the calcium signaling pathway

  • Expression of a calcium-sensitive photoprotein (mt-clytin II has shown efficacy)

  • Confirmation of specific receptor activation through appropriate controls

The key advantage of this system is its ability to assess ligand-induced calcium mobilization without interference from autofluorescent compounds that can produce false positives/negatives in fluorescence-based assays . This is particularly important when screening plant extracts or food samples that may contain compounds affecting TAS2R60 function.

How can researchers address challenges in comparing functional data between human and Pan paniscus TAS2R60?

When conducting comparative functional studies between human and Pan paniscus TAS2R60, several methodological considerations are critical:

Standardization of expression constructs is essential, as variations in signal sequences, epitope tags, or vector backbones can significantly impact receptor expression levels and functionality. Researchers should implement identical expression systems for both orthologs, using the same:

  • Cell line (e.g., AD-293 or 293AD) with equivalent passage numbers

  • Signal sequence tags (the M3 receptor signal sequence has shown promise for some TAS2Rs)

  • Assay readout systems (bioluminescence-based calcium assays provide reliable results)

  • Internal controls to normalize for expression level differences

When comparing EC50 values or response amplitudes, researchers should acknowledge that variations may arise from methodological differences rather than intrinsic receptor properties. Published data show that deviations in potency values can occur due to different assay formats, readouts, processing parameters, cell lines, and ligand preparation methods . To mitigate these confounding factors, implement rigorous control conditions including cells expressing Gα16-gust44 and mt-clytin II without the receptor, or expressing mt-clytin II alone, to exclude non-specific activation of endogenous GPCRs or calcium channels .

What are effective strategies for purifying recombinant Pan paniscus TAS2R60 for structural studies?

Purification of recombinant Pan paniscus TAS2R60 for structural studies presents significant challenges due to its hydrophobic transmembrane domains. A systematic approach involves:

Purification StageMethodologyCritical Considerations
Expression system selectionInsect cells (Sf9/Hi5) or mammalian cells (HEK293)Higher protein yields vs. native-like glycosylation
SolubilizationDetergent screening (DDM, LMNG, or digitonin)Maintaining structural integrity
Affinity purificationTandem affinity tags (His-MBP or His-SUMO)Enhancing solubility and purification efficiency
Lipid reconstitutionNanodiscs or lipid cubic phaseStabilizing native conformation

For successful structural studies, researchers should consider implementing crystallization chaperones or thermostabilizing mutations to enhance structural stability. Given that TAS2Rs possess a 7-transmembrane structure with conserved short N- and C-terminal domains , the purification strategy must be carefully optimized to maintain functional integrity throughout the process. N-glycosylation at the conserved site in the second extracellular loop is crucial for receptor trafficking , and this post-translational modification must be preserved or managed during purification to obtain structurally relevant samples.

How has dietary adaptation influenced the evolution of TAS2R60 in Pan paniscus compared to other primates?

The evolution of TAS2R60 in Pan paniscus must be considered within the broader context of bitter taste receptor evolution in primates, which shows significant correlation with dietary adaptations. Research indicates that the number of intact bitter taste receptor genes (TAS2Rs) significantly correlates with diet, suggesting that dietary preferences drive TAS2R evolution in primates .

For Pan paniscus specifically, their largely herbivorous diet with occasional omnivory likely shapes their TAS2R repertoire. Evolutionary analysis of primate TAS2R genes reveals that:

  • Gene duplication serves as a primary mechanism for TAS2R repertoire expansion, with massive tandem duplications observed in certain primate lineages

  • Certain TAS2R clades show lineage-specific patterns, with some being anthropoid-specific while others appear Strepsirrhini-specific

  • The functional diversity of TAS2R repertoires correlates with the diversity of plant secondary compounds encountered in different diets

When studying Pan paniscus TAS2R60, researchers should consider its evolutionary context within anthropoid primates and potential adaptive responses to diet-specific bitter compounds. Comparative analysis with human TAS2R60 may reveal subtle functional differences reflecting divergent dietary adaptations between these closely related species.

What methodological approaches are most effective for analyzing selective pressure on Pan paniscus TAS2R60?

To effectively analyze selective pressure on Pan paniscus TAS2R60, researchers should implement multiple computational and experimental approaches:

For computational analysis:

  • Calculate dN/dS ratios across the coding sequence, with particular attention to the extracellular domains potentially involved in ligand binding

  • Perform branch-site models to detect episodic selection specific to the Pan paniscus lineage

  • Implement site-specific evolutionary rate analysis to identify functionally important residues under purifying selection

Experimental validation should include:

  • Mutagenesis of putatively selected sites followed by functional characterization

  • Comparative ligand screening against human and Pan paniscus TAS2R60 to detect functional divergence

  • Analysis of receptor activation profiles across a diverse set of bitter compounds relevant to Pan paniscus diet

This integrated approach enables researchers to connect molecular evolution with functional divergence, providing insights into how selective pressures linked to dietary adaptations have shaped TAS2R60 function . Given that bitter taste perception plays a critical role in deterring animals from consuming harmful and toxic substances , differences in selective pressure may reflect adaptation to different plant secondary compounds in the respective environments of humans and bonobos.

How can researchers effectively study the extraoral functions of Pan paniscus TAS2R60?

Investigating the extraoral functions of Pan paniscus TAS2R60 requires innovative experimental approaches that address tissue-specific expression and signaling pathways:

For tissue expression profiling:

  • Employ RT-qPCR with highly specific primers to detect low-abundance transcripts in extraoral tissues

  • Validate expression using RNAscope or other in situ hybridization techniques for spatial resolution

  • Consider single-cell transcriptomics to identify specific cell populations expressing TAS2R60

For functional characterization in extraoral contexts:

  • Develop tissue-specific primary cell cultures or organoids from Pan paniscus samples

  • Implement calcium imaging or bioluminescence assays optimized for specific tissue contexts

  • Examine downstream signaling pathways that may differ from canonical taste signaling

This research direction is particularly important as TAS2Rs, including TAS2R60, are now known to be expressed in multiple extraoral systems including digestive, respiratory, genitourinary, brain, and immune cells . While canonical TAS2Rs function in taste buds to detect bitter compounds and prevent ingestion of potentially harmful substances, their extraoral functions may include roles in detecting environmental compounds, regulating immune responses, or mediating other physiological processes . Comparative studies between human and Pan paniscus systems may reveal evolutionary adaptations in these extraoral functions.

What are the most reliable methods for identifying ligands that activate Pan paniscus TAS2R60?

Implementing a systematic approach to ligand identification for Pan paniscus TAS2R60 requires multiple complementary methodologies:

For primary screening:

  • Develop a cell-based functional assay with recombinant Pan paniscus TAS2R60 co-expressed with Gα16-gust44 and mt-clytin II for bioluminescence-based calcium detection

  • Screen compound libraries including known bitter tastants, plant extracts, and compounds reflecting the natural diet of Pan paniscus

  • Include appropriate controls to rule out non-specific activation of endogenous receptors or calcium pathways

For validation and characterization:

  • Generate full dose-response curves for hit compounds to determine EC50 values and efficacy parameters

  • Compare activation profiles with human TAS2R60 to identify species-specific responses

  • Conduct molecular docking or mutational analysis to identify key residues involved in ligand recognition

The bioluminescence-based assay approach offers significant advantages for complex natural samples as it avoids interference from autofluorescent compounds that can produce false positives or negatives in fluorescence-based assays . This is particularly relevant when screening plant extracts that might reflect the natural diet of Pan paniscus. Researchers should standardize experimental conditions, as variables including assay format, readout parameters, cell line selection, and ligand preparation methods can significantly impact potency measurements .

How can researchers investigate the molecular mechanisms of Pan paniscus TAS2R60 signaling?

Investigating signaling mechanisms for Pan paniscus TAS2R60 requires a multifaceted approach addressing both canonical and non-canonical pathways:

For canonical GPCR signaling:

  • Characterize G-protein coupling preferences using BRET-based assays with different Gα subunits

  • Assess β-arrestin recruitment dynamics and internalization patterns following activation

  • Measure secondary messenger (calcium, cAMP) kinetics with temporal resolution

For pathway analysis:

  • Implement phosphoproteomics to identify downstream targets following receptor activation

  • Use selective inhibitors to dissect pathway components contributing to the observed response

  • Compare signaling outcomes in different cellular contexts (heterologous vs. native cell types)

A comprehensive investigation must also address receptor regulation:

  • Analyze receptor desensitization patterns following repeated or prolonged stimulation

  • Identify potential site-specific post-translational modifications affecting receptor function

  • Examine potential heterologous regulation by other signaling systems

What are common challenges in expressing functional recombinant Pan paniscus TAS2R60 and how can they be addressed?

Researchers working with recombinant Pan paniscus TAS2R60 commonly encounter several expression challenges that require systematic troubleshooting:

ChallengePossible CausesSolutions
Low surface expressionInefficient traffickingTest different signal sequences (M3 signal sequence has shown superiority for some TAS2Rs)
Protein misfoldingInclude chaperones or optimize culture temperature
Insufficient glycosylationEnsure preservation of N-glycosylation sites, particularly in the second extracellular loop
Poor functional responseInadequate G-protein couplingCo-express with chimeric G-proteins (Gα16-gust44)
Low receptor expressionOptimize codon usage for expression system
Ineffective detection systemImplement bioluminescence-based calcium assays instead of fluorescence-based methods

Empirical testing of different cell lines is crucial, as some TAS2Rs may express well in one cell line but not another due to various factors affecting gene expression capacity . When troubleshooting functional expression, researchers should test both the AD-293 and 293AD cell lines, which have demonstrated strong adherent properties facilitating media changes during assay procedures .

The addition of signal sequences significantly improves functional expression by enhancing receptor trafficking to the cell surface. While SST3 and Rho signal sequences have been traditionally used, the M3 receptor signal sequence has demonstrated superior performance for some TAS2Rs, potentially due to the introduction of additional N-glycosylation sites that enhance receptor folding and trafficking .

How can researchers troubleshoot inconsistent functional responses in Pan paniscus TAS2R60 assays?

Addressing inconsistent functional responses in Pan paniscus TAS2R60 assays requires systematic evaluation of multiple experimental parameters:

For assay-related variables:

  • Control for cell passage number and density, as receptor expression levels can vary significantly across passages

  • Standardize ligand preparation methods, as compound solubility and storage can affect potency measurements

  • Implement internal standards and positive controls in each experiment to normalize responses

For receptor-specific considerations:

  • Verify surface expression levels via immunostaining or surface biotinylation between experiments

  • Assess receptor stability under assay conditions using ligand binding at different time points

  • Evaluate potential desensitization or internalization affecting response magnitude

When comparing experimental data to literature values, researchers should recognize that deviations in potency values may result from differences in assay format, readout parameters, cell lines, and ligand preparation methods . To minimize non-specific responses, include appropriate control conditions (cells expressing Gα16-gust44 and mt-clytin II without the receptor, or expressing mt-clytin II alone) to exclude activation of endogenous GPCRs or calcium channels .

What considerations are important when designing comparative studies between human and Pan paniscus TAS2R60?

Designing rigorous comparative studies between human and Pan paniscus TAS2R60 requires careful attention to multiple experimental parameters:

Critical experimental design elements include:

  • Identical expression constructs with the same vector backbone, regulatory elements, and signal sequences

  • Matched expression levels validated through quantitative methods (flow cytometry or Western blotting)

  • Parallel testing in identical experimental conditions (same passage cells, reagents, and protocols)

  • Comprehensive ligand panels including both shared and species-specific dietary compounds

For data analysis:

  • Implement rigorous statistical approaches accounting for inter-experimental variability

  • Consider both quantitative parameters (EC50, Emax) and qualitative response patterns

  • Validate key findings with alternative assay methodologies or in different cell backgrounds

When interpreting species differences, researchers should consider evolutionary and ecological contexts. The significant correlation between TAS2R repertoire and diet in primates suggests that any functional differences between human and Pan paniscus TAS2R60 may reflect dietary adaptations. Molecular evolutionary analyses can complement functional studies by identifying sites under positive selection that may contribute to functional divergence between species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.