Recombinant Pan paniscus Taste receptor type 2 member 62 (TAS2R62)

Shipped with Ice Packs
In Stock

Description

Introduction to TAS2R62

TAS2R62 belongs to the taste receptor type 2 (TAS2R) family, which is responsible for the detection of bitter compounds in food sources. These G protein-coupled receptors are primarily expressed in taste cells and serve as a crucial defense mechanism against the ingestion of potentially toxic substances. The study of recombinant taste receptors provides valuable insights into the molecular mechanisms of taste perception and the evolutionary adaptations of different primate species to their dietary environments.

Evolutionary Context of Bitter Taste Receptors

Bitter taste perception plays a fundamental role in deterring animals from consuming harmful and toxic substances, making it an essential survival mechanism across species . Within the primate lineage, TAS2R genes have undergone significant evolutionary adaptations, with the total number of TAS2R genes ranging from 27 to 51 across different primate species . These genes are typically concentrated on 2 to 4 scaffolds within each species' genome, with closely related genes often appearing as tandem duplications on the same scaffold .

TAS2R62 in Pan paniscus

Pan paniscus (bonobo) is a close evolutionary relative to humans, sharing approximately 98.7% of DNA. The TAS2R62, as one of the bitter taste receptors in this species, offers important comparative data for understanding human taste perception and the evolutionary divergence of sensory systems among closely related primate species.

Protein Structure and Composition

Recombinant Full Length Pan paniscus Taste Receptor Type 2 Member 62 (TAS2R62) is a protein consisting of 312 amino acids (positions 1-312) with a His-tag fused to its N-terminal region . The protein is expressed in E. coli expression systems to facilitate production and purification for research purposes .

Phylogenetic Context

Taste receptor type 2 genes have been classified into 21 distinct clades based on phylogenetic analysis, with some clades showing anthropoid-specific, Strepsirrhini-specific, or Cercopithecidae-specific duplications . While the search results don't specify the particular clade of TAS2R62, understanding the evolutionary relationships among TAS2R genes provides important context for interpreting the function and significance of individual receptors like TAS2R62.

Comparative Analysis with Other TAS2R Members

The TAS2R family exhibits varying degrees of receptor tuning, with some receptors responding to a narrow range of bitter compounds and others showing broader reactivity. For example, TAS2R2, a different member of this receptor family in humans, responds to approximately 7% of tested bitter compounds, classifying it as an "intermediately tuned" receptor .

While specific information about the tuning of TAS2R62 is not provided in the search results, the functional characteristics of other TAS2R family members suggest that TAS2R62 likely plays a role in detecting a specific subset of bitter compounds relevant to the dietary patterns and ecological niche of Pan paniscus.

Dietary Influences on Receptor Numbers

Research has demonstrated a significant correlation between the number of intact TAS2R genes and the dietary preferences of primate species . Phylogenetically independent contrast analysis has revealed that omnivorous primates possess a higher average number of functional TAS2R genes (26.88) compared to herbivores (23.29) and carnivores (20.67) . This pattern suggests that dietary habits have been a significant driver in the evolution of bitter taste receptors across primate lineages.

Dietary Adaptations and Selective Pressures

Nearly all plants utilize chemical defenses to protect themselves from herbivores, and most Cercopithecidae species (Old World monkeys) are herbivores . The increased number of TAS2R genes in these species is likely an adaptation for detecting multiple chemical compounds present in their plant-based diets. For instance, cercopithecines primarily consume unripe fruit, seeds, and underground storage organs containing large quantities of bitter materials, while colobine monkeys mainly eat tannin-rich leaves and other herbaceous vegetation .

Although the specific dietary role of TAS2R62 in Pan paniscus is not explicitly detailed in the search results, bonobos are primarily herbivorous with a diet consisting mainly of fruits, leaves, and occasional small prey. The presence and conservation of TAS2R62 in this species likely reflects its importance in detecting bitter compounds relevant to the bonobo's dietary pattern.

Functional Screening Methodologies

Recombinant taste receptors can be utilized in functional screening assays to identify activating compounds. Similar to studies conducted with TAS2R2, calcium mobilization assays using transiently transfected cells provide a method for assessing receptor responses to various bitter compounds . While specific functional studies of TAS2R62 are not detailed in the search results, the methodologies employed for other TAS2R receptors could be applied to characterize the activation profile of TAS2R62.

Potential Applications in Comparative Genomics

The study of recombinant TAS2R62 holds significant value for comparative genomic research, potentially elucidating the evolutionary relationships between bonobos, humans, and other primates. By comparing receptor structures, binding affinities, and activation profiles across species, researchers can gain insights into the evolutionary forces that have shaped taste perception in response to dietary specializations and environmental adaptations.

Biotechnological and Pharmaceutical Applications

Recombinant taste receptors like TAS2R62 have potential applications in biotechnology and pharmaceutical research, including:

  1. Development of bitter taste blockers for improving the palatability of medications

  2. Creation of novel bitter compounds for deterring consumption of toxic substances

  3. Understanding species-specific taste preferences for evolutionary and ecological studies

  4. Development of in vitro taste assessment systems to reduce reliance on animal testing

Expression and Purification

The recombinant TAS2R62 protein described in the search results is expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . This approach allows for the production of sufficient quantities of the protein for structural and functional studies, though membrane proteins like taste receptors can present significant challenges in expression and purification due to their hydrophobic domains.

Reconstitution Guidelines

For research applications, proper reconstitution of the lyophilized protein is critical. The recommended protocol includes:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol (5-50% final concentration) for long-term storage

  4. Aliquoting to avoid repeated freeze-thaw cycles

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TAS2R62; Taste receptor type 2 member 62; T2R62
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
TAS2R62
Target Protein Sequence
MPSLPTLIFIAIFCLESLAAMLQNGFLVTMLGREWVRCRMLSTSDMIVACLAASRFCLHG VAMANNLLASLDFSRAVPYMNIFWDLFNALTLWFTALLAAFYCVKISSFSHPTFAWLKWR ISRLVPKLIKGSLIICGLEVISSATGNILFGQRKVSLSSYRNETLVYRVQASFQLYFFLY DGFVWSIPFLLFLVSTVLLIVSLCWQLGQMRDLRPGPCDPSTQAYTMALKSLTFSLIFCT LYFLSLFASALKIINFQNHWHWAWEVLIYANICLHSTVLVLRSPKLKKGLKTWPQLQCPC DAGSQGFGRCWP
Uniprot No.

Target Background

Function

This receptor, potentially involved in bitterness perception, is linked to gustducin. It may play a role in sensing gastrointestinal chemical composition. Receptor activation may stimulate alpha-gustducin, mediate PLC-beta-2 activation, and subsequently gate TRPM5.

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How can researchers distinguish between functional TAS2R62 and its pseudogene counterpart TAS2R62P?

Distinguishing between functional TAS2R62 and its pseudogene TAS2R62P requires multiple analytical approaches:

  • Sequence analysis: Examine for disruptions in the coding sequence such as premature stop codons, frameshift mutations, or loss of start codons that would classify it as a pseudogene .

  • Expression profiling: While functional TAS2R62 should show tissue-specific expression patterns, pseudogenes typically show reduced or absent expression.

  • Phylogenetic analysis: Position in evolutionary trees can help distinguish functional genes from pseudogenes, as pseudogenes often show distinctive evolutionary patterns with accelerated rates of non-synonymous substitutions .

  • Functional testing: Express both variants in heterologous systems to test for receptor activation in response to bitter compounds. Pseudogenes will typically show no functional response .

Researchers should note that TAS2R62P is classified as a pseudogene based on genomic evidence, but its exact evolutionary relationship to functional TAS2R62 may provide insights into taste receptor evolution in primates .

What evolutionary patterns are observed in Pan paniscus TAS2R genes, and how does TAS2R62 fit into the broader picture of bitter taste receptor evolution?

Pan paniscus TAS2R genes show significant evolutionary patterns that reflect their ecological adaptations:

  • Subspecies-specific diversification: Approximately two-thirds of all TAS2R haplotypes in amino acid sequence are unique to each chimpanzee subspecies, suggesting marked diversification at the subspecies level .

  • Different selective pressures: Unlike western chimpanzees (P. t. verus) where balancing selection dominates TAS2R evolution, eastern chimpanzees (P. t. schweinfurthii) show evidence of purifying selection for the "human cluster" of TAS2Rs .

  • Copy number variations: Some TAS2R genes in chimpanzees exhibit whole-gene deletions and other structural variations that may reflect adaptive responses to dietary changes .

What genetic variations in TAS2R62 have been documented across Pan paniscus populations, and what are their functional implications?

Research has documented several forms of genetic variation in TAS2R62 across Pan paniscus populations:

While TAS2R62-specific variation data is limited, the pattern observed across TAS2R genes in Pan species suggests that these variations likely reflect adaptations to different dietary sources of bitter compounds. Unlike some other TAS2R members such as TAS2R38, TAS2R43, and TAS2R46 that show evidence of pseudogenization through loss of start codons or gain of stop codons in certain populations, TAS2R62 appears to maintain functional integrity across most Pan paniscus populations studied .

What are the optimal expression systems for producing recombinant Pan paniscus TAS2R62, and how do they compare in terms of protein yield and functionality?

Multiple expression systems have been employed for recombinant TAS2R62 production, each with distinct advantages:

Expression SystemAdvantagesDisadvantagesYieldFunctionality
E. coliCost-effective, rapid growth, established protocolsLacks post-translational modifications, membrane protein folding challengesModerate to high with optimizationMay require refolding for functionality
Cell-free expressionAvoids toxicity issues, direct access to reaction conditionsHigher cost, lower scalabilityVariable, often lower than cellular systemsOften preserves functionality
Mammalian cells (HEK293, CHO)Native-like post-translational modifications, proper foldingHigher cost, slower growthLower than bacterial systemsHighest functional relevance
Yeast (P. pastoris, S. cerevisiae)Eukaryotic modifications, high density cultureMedium complexityModerate to highGood functionality

What purification strategies yield the highest quality recombinant TAS2R62 suitable for structural and functional studies?

Purification of high-quality recombinant TAS2R62 requires a multi-step approach:

  • Initial capture: Utilize affinity chromatography with Ni-NTA resin targeting the N-terminal His-tag. Optimal conditions include:

    • Buffer composition: Tris/PBS-based buffer, pH 8.0

    • Addition of 6% trehalose as stabilizer

    • Inclusion of mild detergents (0.1% DDM or 0.5% CHAPS) to maintain membrane protein solubility

  • Intermediate purification:

    • Size exclusion chromatography to separate monomeric receptor from aggregates

    • Ion exchange chromatography to remove contaminating proteins

  • Final polishing:

    • Lipid reconstitution for functional studies

    • Buffer optimization with inclusion of glycerol (5-50%) for long-term storage

To achieve ≥85-90% purity as determined by SDS-PAGE, researchers should implement rigorous quality control measures, including Western blotting to confirm identity, circular dichroism to verify secondary structure, and thermal stability assays to assess proper folding .

What experimental approaches are most effective for characterizing the ligand binding properties of TAS2R62, and what bitter compounds have been identified as potential ligands?

Effective experimental approaches for characterizing TAS2R62 ligand binding include:

  • Calcium imaging assays: Transfect cells with TAS2R62 along with a promiscuous G protein (Gα16) and measure calcium flux upon receptor activation using fluorescent calcium indicators like Fura-2 or genetically encoded calcium indicators.

  • BRET/FRET-based assays: Monitor conformational changes upon ligand binding using bioluminescence or fluorescence resonance energy transfer.

  • Electrophysiological recordings: Patch-clamp techniques to measure receptor-activated ion channel responses in heterologous expression systems.

  • Competitive binding assays: Use radiolabeled or fluorescent bitter compounds to determine binding affinity and selectivity.

While specific ligands for Pan paniscus TAS2R62 have not been comprehensively characterized, research on TAS2R receptors in amphibians has shown they respond to ecologically important xenobiotics . Based on patterns observed in other TAS2R family members, potential ligands may include plant-derived bitter compounds present in the bonobo diet, such as alkaloids, flavonoids, and terpenoids .

How does TAS2R62 expression vary across different tissues in Pan paniscus, and what does this suggest about its broader physiological roles?

While Pan paniscus-specific TAS2R62 tissue expression data is limited, research on TAS2R family members across species provides valuable insights:

  • Multi-tissue expression: TAS2R receptors are expressed beyond the oral cavity, with detection in the brain, stomach, intestines, liver, and skin in amphibian species .

  • Tissue-specific functions: Extra-oral expression suggests roles beyond taste perception, potentially including:

    • Gastrointestinal chemosensing and regulation of digestive functions

    • Immune response modulation

    • Toxin detection in skin

    • Neuronal signaling in the brain

  • Evolutionary implications: Species with larger TAS2R repertoires show more extensive expression outside the oral cavity, suggesting functional diversification accompanies genetic expansion .

For Pan paniscus specifically, researchers should investigate TAS2R62 expression across tissues using quantitative PCR, RNA-seq, or immunohistochemistry to understand its potential roles in extra-oral physiology. The bonobo's frugivorous diet and unique social behaviors may correlate with specialized bitter receptor distribution patterns that differ from other great apes .

How is the TAS2R62 gene organized within the Pan paniscus genome, and how does its genomic context compare to that in related species?

The TAS2R62 gene in Pan paniscus is organized within the genome as part of the TAS2R gene family, which typically exhibits a clustered arrangement:

What are the key structural features of TAS2R62 that differentiate it from other TAS2R family members, and how do these relate to its predicted function?

TAS2R62 contains several key structural features that potentially differentiate it within the TAS2R family:

  • Transmembrane domain organization: As a seven-transmembrane GPCR, TAS2R62 contains the classic TM1-TM7 arrangement with connecting intracellular and extracellular loops .

  • Ligand binding pocket: The extracellular portions of the transmembrane domains and extracellular loops likely form a binding pocket with unique residues that determine ligand specificity.

  • G protein coupling region: The intracellular loops, particularly ICL3, and the C-terminal region contain sequences that determine G protein coupling specificity.

  • Conserved motifs: TAS2R62 contains the characteristic sequence elements of Class T2 receptors, though specific motifs that distinguish it from other family members would require detailed sequence alignment analysis.

The amino acid sequence of TAS2R62 (312 amino acids) suggests a structural organization typical of bitter taste receptors, with potential specialized regions that determine its unique ligand response profile . Without structural data specifically for TAS2R62, researchers can employ homology modeling based on related GPCRs to predict its three-dimensional structure and identify key residues involved in ligand recognition.

What strategies can researchers use to overcome the challenges of working with TAS2R62 as a membrane protein in experimental settings?

Researchers can implement several strategies to address the inherent challenges of working with TAS2R62 as a membrane protein:

  • Protein stabilization approaches:

    • Use of stabilizing agents: Include 6% trehalose in buffer formulations

    • Addition of glycerol (5-50%) for long-term storage stability

    • Cholesterol supplementation to mimic native membrane environment

    • Temperature control during purification (4°C) and storage (-20°C/-80°C)

  • Expression optimization:

    • Codon optimization for the expression system used

    • Fusion with stabilizing partners (e.g., T4 lysozyme, BRIL)

    • Inducible expression systems to control protein production rates

    • Use of specialized E. coli strains designed for membrane protein expression

  • Solubilization and reconstitution:

    • Screen detergents for optimal solubilization (DDM, LMNG, etc.)

    • Reconstitution into nanodiscs or liposomes for functional studies

    • Use of styrene maleic acid lipid particles (SMALPs) for native-like environments

  • Structural stabilization for analysis:

    • Site-directed mutagenesis to remove flexible regions

    • Introduction of disulfide bonds to stabilize conformation

    • Antibody fragment co-crystallization for structural studies

Implementing these approaches can significantly improve the quantity and quality of TAS2R62 for biochemical, biophysical, and structural characterization studies .

How can researchers design in vitro functional assays to accurately assess TAS2R62 activation by potential ligands?

Designing effective in vitro functional assays for TAS2R62 requires careful consideration of receptor expression, signaling components, and detection methods:

  • Heterologous expression systems:

    • HEK293 or CHO cells for mammalian expression

    • Include chimeric G proteins (Gα16-gust44) to couple bitter taste receptor activation to calcium signaling

    • Co-expression with relevant signaling components like gustducin, PLCβ2, and TRPM5

  • Reporter systems:

    • Calcium-sensitive fluorescent dyes (Fluo-4, Fura-2) for real-time imaging

    • Genetically encoded calcium indicators (GCaMP variants)

    • Luciferase-based reporters for cAMP or IP3 generation

    • Impedance-based cellular assays for label-free detection

  • Assay optimization:

    • Determine optimal cell density and receptor expression levels

    • Establish positive controls using characterized TAS2R agonists

    • Include inhibitors of endogenous signaling pathways

    • Validate with dose-response curves to determine EC50 values

  • Data analysis approaches:

    • Normalize responses to positive controls

    • Calculate Z-factor to assess assay robustness

    • Apply appropriate statistical methods for comparing responses

Based on research with amphibian TAS2Rs, which detected responses to ecologically relevant compounds, researchers should test TAS2R62 against a diversity of bitter compounds found in the Pan paniscus habitat and diet .

How does the genomic diversity of TAS2R62 in Pan paniscus compare to that in other great apes, and what does this reveal about dietary adaptations?

The genomic diversity of TAS2R62 in Pan paniscus, when compared to other great apes, provides insights into evolutionary dietary adaptations:

Researchers should conduct comparative genomic analyses of TAS2R62 across Pan paniscus, Pan troglodytes subspecies, and other great apes to establish correlations between genetic variations and known dietary preferences.

What insights can be gained from studying TAS2R62 expression patterns outside the oral cavity in Pan paniscus compared to other species?

Studying extra-oral TAS2R62 expression in Pan paniscus can provide valuable insights into the broader physiological roles of bitter taste receptors:

  • Physiological functions beyond taste: Extra-oral expression suggests TAS2R62 may function in:

    • Gut chemosensation and nutrient processing

    • Immune cell regulation

    • Respiratory tract defense mechanisms

    • Neurological signaling

  • Comparative expression patterns: While Pan paniscus-specific data is limited, research in amphibians shows that species with larger TAS2R repertoires exhibit more expression outside the mouth, suggesting functional diversification .

  • Tissue-specific adaptations: TAS2R expression in the skin of toads has been linked to sensing skin toxins, suggesting species-specific adaptations to environmental chemical challenges . For bonobos, potential skin expression might relate to environmental compound detection.

  • Evolutionary implications: The correlation between TAS2R count and extra-oral expression suggests that as TAS2R genes expanded during evolution, they acquired new sensing roles beyond oral taste perception .

To gain these insights, researchers should employ comparative transcriptomics across tissues in Pan paniscus, other great apes, and more distantly related species, analyzing expression patterns in relation to ecological niches and physiological requirements.

What are the most promising directions for future research on Pan paniscus TAS2R62, and what technological advances would enable these studies?

Future research on Pan paniscus TAS2R62 should focus on several promising directions:

  • Structural characterization:

    • Cryo-EM or X-ray crystallography of TAS2R62 to determine its three-dimensional structure

    • Molecular dynamics simulations to understand ligand binding mechanisms

    • Structure-based drug design targeting TAS2R62

  • Functional diversity:

    • Comprehensive profiling of TAS2R62 responses to dietary compounds from the bonobo's natural habitat

    • Investigation of potential endogenous ligands for TAS2R62

    • Characterization of signaling pathways downstream of TAS2R62 activation

  • Ecological and evolutionary biology:

    • Field studies correlating genetic variations with feeding behaviors in wild bonobos

    • Comparative genomics across Pan species with different dietary preferences

    • Investigation of potential gene-culture co-evolution in bitter taste perception

  • Technological advances enabling these studies:

    • Single-cell RNA sequencing to map cell-specific expression patterns

    • CRISPR-Cas9 genome editing in cell models to study TAS2R62 function

    • Advanced computational methods to predict ligand binding

    • Development of bonobo-derived cell lines for more physiologically relevant studies

These research directions would significantly advance our understanding of TAS2R62's role in bonobo physiology, ecology, and evolution .

How might understanding TAS2R62 function contribute to broader research on sensory ecology and primate evolution?

Understanding TAS2R62 function can contribute significantly to broader research on sensory ecology and primate evolution:

  • Evolutionary adaptation mechanisms:

    • Insight into how primates adapt to changing food resources through sensory receptor evolution

    • Evidence for co-evolution between plant secondary compounds and primate taste receptors

    • Understanding of molecular mechanisms underlying dietary specialization

  • Comparative sensory biology:

    • Framework for comparing chemosensory adaptations across primate lineages

    • Correlation between sensory receptor repertoires and ecological niches

    • Insights into how sensory systems shape foraging strategies

  • Behavioral ecology connections:

    • Links between taste perception capabilities and food choice behaviors

    • Understanding of how taste receptors influence dietary breadth and specialization

    • Insights into toxin avoidance strategies in different primate species

  • Conservation implications:

    • Knowledge of how taste perception affects food choice could inform conservation strategies

    • Understanding of how habitat changes might affect primate feeding ecology through sensory constraints

    • Potential for predicting how primates might respond to changing food availability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.