Recombinant Pan paniscus Taste receptor type 2 member 64 (TAS2R64)

Shipped with Ice Packs
In Stock

Description

Ligand Interactions

LigandSpecies-Specific ActivationFunctional ImplicationSource
AmarogentinHuman TAS2R64 (pseudogene restored)Bitter taste perception in humans
ColchicineHuman TAS2R2 (but not TAS2R64)Toxicity detection
ChloroquineSimilar activity in human and chimpanzeeAntimalarial drug detection

Key Observations:

  • Species-Specific Recognition: TAS2R64 in humans is a pseudogene, while its chimpanzee ortholog is functional. Pan paniscus TAS2R64 likely shares functional similarities with chimpanzee TAS2R64 .

  • Glycosylation: N-linked glycosylation in the second extracellular loop is critical for receptor maturation and surface localization, as shown in human TAS2Rs .

Research Applications

TAS2R64 is utilized in comparative studies to elucidate evolutionary adaptations in bitter taste perception.

Comparative Evolutionary Studies

FocusFindingsMethodologySource
Human vs. ChimpanzeeHuman TAS2R64 pseudogenization linked to dietary shifts; chimpanzee retains functionalityHeterologous expression, ligand screening
Primate TAS2R DiversityHigh genetic diversity in primates correlates with environmental toxin exposurePopulation genetics

Example: Restored human TAS2R64 pseudogenes activated by amarogentin (a gentian-derived compound), while chimpanzee TAS2R64 recognized umbelliferone (plant-derived) .

Future Directions

  • Ligand Discovery: Screening for Pan paniscus TAS2R64-specific agonists using high-throughput assays.

  • Evolutionary Analysis: Investigating TAS2R64 pseudogenization in hominins and its dietary implications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
TAS2R64; Taste receptor type 2 member 64; T2R64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
TAS2R64
Target Protein Sequence
MVYFLLIILSILVVFAFVLGNFSNGFVALVNVIDWVKTRKISSADQILTALVVSRIGLLW VILFHWYANVFNSALYSSEVGAVASNISAIINHFSIWLAASLGIFYLLKIANFSNLIFLH LKKRIRSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSDLTVS TLANLIPFILTLICFLLLICSLHKHLKKMQLHGKGSQDLSTKVHIKALQTVISFLMLYAI YFLYLITLTWNLWTQQNKLVFLLCQTLGIMYPSFHSFFLIMGSRKLKQTFLSVLCQVTCL VKGQQPSTP
Uniprot No.

Target Background

Function
This receptor potentially plays a role in the perception of bitterness and is linked to gustducin. It may contribute to sensing the chemical composition of gastrointestinal contents. Activation of this receptor can stimulate alpha gustducin, mediate PLC-beta-2 activation, and potentially lead to TRPM5 gating.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should recombinant TAS2R64 be properly stored and handled in laboratory settings?

For optimal stability of recombinant Pan paniscus TAS2R64, storage at -20°C is recommended for routine use, while extended storage should be at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for this specific protein .

Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise protein integrity and function . For experimental consistency, it is advisable to prepare single-use aliquots upon receipt of the recombinant protein to minimize potential degradation from multiple handling events.

What experimental controls are essential when studying TAS2R64 function?

When investigating TAS2R64 function, several control measures should be implemented:

  • Negative controls: Include experiments with non-bitter compounds to confirm receptor specificity

  • Positive controls: Test known bitter ligands that activate similar TAS2R receptors

  • Expression controls: Verify TAS2R64 expression levels using appropriate antibodies before functional assays

  • Species comparisons: When possible, compare with human or chimpanzee TAS2R homologs to identify species-specific responses

Implementation of a two-group pre/post design allows for assessment of baseline conditions before experimental manipulation, particularly important when examining cellular responses to TAS2R64 activation2.

What techniques are most effective for studying taste receptor regeneration in relation to TAS2R64?

For investigating TAS2R64 regeneration dynamics, BrdU (5-bromo-2-deoxyuridine) pulse-chase labeling provides valuable insights. The recommended protocol involves:

  • Administer BrdU injections (100 mg/kg) twice daily for six consecutive days to label all proliferating cells

  • Allow for chase periods (typically 2-6 weeks) to identify label-retaining cells (LRCs)

  • Perform bilateral glossopharyngeal nerve transection (GLx) to induce taste bud degeneration

  • Collect tissue samples at defined timepoints (e.g., 2 and 6 weeks post-GLx)

  • Use immunohistochemical staining with specific markers such as Gα gustducin (Type II taste receptor cell marker) and Snap25 (Type III taste receptor cell marker)

This approach allows for identification of taste receptor cells that remain without degeneration despite nerve injury and can participate in taste bud regeneration. The number of LRCs typically decreases significantly between 2 and 6 weeks after chasing (4.17 ± 1.6 SD at 2 weeks vs. 1.77 ± 0.85 SD at 6 weeks) .

How can researchers design robust experimental protocols to study TAS2R64 function?

A robust experimental design for TAS2R64 functional studies should incorporate:

  • Random assignment: Participants or samples should be randomly allocated to experimental conditions to control for confounding variables

  • Pre/post measurements: When applicable, measure dependent variables before and after experimental manipulation to account for baseline differences

  • Solomon four-group design consideration: This design combines the advantages of pre/post testing with the ability to control for testing effects

  • Within/repeated measures elements: Where appropriate, use within-subject designs to control for individual differences in taste perception2

When conducting experiments with non-human primates like bonobos, computerized simulations can complement physical experiments. For example, when studying cognitive aspects of taste perception, a design similar to the spatial transposition tasks used with bonobos can be adapted, where animals track multiple stimuli on computer monitors after being trained with physical objects .

What are the recommended approaches for quantifying TAS2R64 expression in taste cells?

To accurately quantify TAS2R64 expression in taste cells, consider the following methodological approach:

  • Tissue preparation: Obtain circumvallate papilla or other taste tissue containing TAS2R64-expressing cells

  • Marker identification: Use specific antibodies against TAS2R64 or reporter constructs

  • Quantification strategy:

    • Count positively stained cells per taste bud

    • Measure fluorescence intensity as a proxy for expression level

    • Compare expression across different taste bud populations

For statistical analysis, a robust approach involves:

Analysis ComponentRecommended MethodKey Considerations
Data CollectionCell counting with blinded observersMinimum 20 taste buds per condition
Statistical TestANOVA with post-hoc testsCheck assumptions of normality
PresentationBox plots with individual data pointsShow both means and distributions
ReproducibilityReport exact p-values and effect sizesEnable power calculations for future studies

For publication-quality tables of results, researchers can employ statistical software packages with commands that generate formatted outputs directly from analysis results .

How should researchers interpret apparent contradictions in TAS2R64 functional data?

When facing contradictory results in TAS2R64 studies, implement this systematic approach:

When presenting contradictory findings, create comparative data tables rather than lists, following formal academic style guidelines and citing sources inline .

What considerations are important when analyzing TAS2R64 sequence conservation across primates?

When analyzing TAS2R64 sequence conservation:

  • Alignment methodology: Use appropriate algorithms for G protein-coupled receptor alignments that account for transmembrane domain conservation

  • Functional domain focus: Pay particular attention to ligand-binding domains and G-protein coupling regions

  • Selection pressure analysis: Calculate dN/dS ratios to identify regions under positive or purifying selection

  • Correlation with behavioral data: Connect sequence variations to known differences in bitter taste perception among primate species

Researchers should extend beyond simple sequence identity percentages to analyze specific amino acid substitutions and their predicted functional consequences. Consider creating a table that maps critical amino acid positions to their potential functional roles based on structural modeling and experimental data from related receptors.

How can researchers effectively use recombinant TAS2R64 in cell-based assays?

For cell-based assays using recombinant TAS2R64:

  • Expression system selection: Choose between mammalian (HEK293, CHO) or insect cell systems based on research questions

  • Functional readouts: Implement multiple assay systems:

    • Calcium imaging to measure immediate receptor activation

    • cAMP assays to assess G-protein coupling

    • β-arrestin recruitment for receptor internalization dynamics

  • Validation strategy:

    • Confirm surface expression using confocal microscopy

    • Verify protein size via Western blotting

    • Test with known bitter compounds to establish proper folding and function

A critical consideration is the tag type, which will be determined during the production process and may affect receptor function or antibody recognition . Researchers should validate that the tag does not interfere with the natural function of the receptor before proceeding with downstream applications.

What approaches enable study of TAS2R64 involvement in taste bud regeneration?

To investigate TAS2R64's role in taste bud regeneration:

  • Nerve injury model: Implement bilateral glossopharyngeal nerve transection (GLx) to induce taste bud degeneration

  • Cell fate tracking: Use BrdU labeling combined with immunohistochemistry for TAS2R64 and other taste cell markers

  • Temporal analysis: Sample at multiple timepoints (e.g., 2 and 6 weeks post-injury) to track regeneration dynamics

  • Functional recovery assessment: Combine morphological assessment with behavioral taste tests to correlate structure with function

This approach reveals that a subset of taste receptor cells, including those expressing TAS2R64, can exhibit stem/progenitor-like characteristics following nerve injury, potentially participating in taste bud regeneration . The model supports the concept that dedifferentiated taste receptor cells work in combination with stem/progenitor cells to enhance taste bud regeneration following nerve injury .

What emerging technologies show promise for advancing TAS2R64 research?

Several cutting-edge approaches hold potential for TAS2R64 research:

  • CRISPR/Cas9 gene editing: For creating precise mutations to study structure-function relationships

  • Organoid models: Development of taste bud organoids to study TAS2R64 in a more physiologically relevant context

  • Single-cell RNA sequencing: To characterize heterogeneity in TAS2R64-expressing cells within taste buds

  • Cryo-EM structural studies: To determine the three-dimensional structure of TAS2R64 in different activation states

These approaches would significantly advance our understanding of TAS2R64 beyond current methodologies and potentially resolve contradictions in existing literature.

How might comparative studies between human and Pan paniscus TAS2R64 inform evolutionary taste biology?

Comparative studies between human and bonobo TAS2R64 offer valuable insights into evolutionary taste biology:

  • Functional divergence analysis: Identify differences in ligand specificity that might reflect dietary adaptations

  • Behavioral correlation: Connect receptor variations to documented differences in food preferences between species

  • Environmental adaptation: Examine whether sequence differences correlate with habitat-specific toxins or food sources

  • Genetic polymorphism: Compare intraspecies variation to understand selective pressures within populations

Such studies would benefit from combining molecular techniques with behavioral experiments similar to those described in spatial cognition research with bonobos and chimpanzees , but adapted specifically for taste perception paradigms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.