Recombinant Pan paniscus Taste receptor type 2 member 66 (TAS2R66)

Shipped with Ice Packs
In Stock

Description

Introduction to TAS2R66

Recombinant Pan paniscus Taste Receptor Type 2 Member 66 (TAS2R66) is a genetically engineered protein derived from the bitter taste receptor gene TAS2R66 in bonobos (Pan paniscus). As a member of the TAS2R family of G protein-coupled receptors (GPCRs), TAS2R66 plays a role in detecting bitter compounds, which is critical for dietary selection and toxin avoidance . Recombinant expression enables functional and structural studies of this receptor in vitro, bypassing challenges associated with isolating native proteins from biological tissues .

Protein Architecture

TAS2R66 is a transmembrane protein with a canonical GPCR structure:

  • Amino Acid Sequence: 309 residues (UniProt ID: Q5Y4Y8) .

  • Domains:

    • N-terminal extracellular domain (Venus flytrap module).

    • Seven transmembrane helices.

    • C-terminal intracellular domain .

Table 1: Key Sequence Features

RegionSequence (Partial)
N-terminalMITFLPIIFSILIVVTFVIGNFANGFIALANSIEWFKRQKISFADQILTALAVPRVGLLWVLLLNWYATELNPAFYSIEVR
Transmembrane 3LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVTILANLVPFTVTLISFLLLVCS
C-terminalYFVSVIISVWSFKNLENKPVFMFCQAIGFSCSSAHPFILIWGNKKLKQPFLSVLWQMRYWVKGEKPSSS

Source:

Post-Translational Modifications

  • Tags: Recombinant TAS2R66 is expressed with an N-terminal 10xHis tag for purification .

  • Glycosylation: Predicted sites are absent due to prokaryotic (E. coli) expression systems .

Expression System

  • Host: Escherichia coli (E. coli) .

  • Vector: Optimized for high-yield soluble expression.

Functional Validation

  • Ligand Binding Assays: Limited data on specific agonists/antagonists, but conserved bitter compound sensitivity inferred from TAS2R orthologs .

  • Stability: Repeated freeze-thaw cycles degrade activity; working aliquots stored at 4°C for ≤1 week .

Functional Studies

  • Bitter Taste Perception: Elucidate ligand specificity and signal transduction mechanisms in bonobos .

  • Evolutionary Comparisons: Contrast with chimpanzee (Pan troglodytes) TAS2Rs to understand dietary adaptation .

Pharmacological Screening

  • Drug Discovery: Identify bitter-masking compounds or bitter receptor modulators .

Evolutionary Context

  • Gene Expansion: Amphibians exhibit the highest TAS2R diversity, while primates like bonobos have fewer but specialized receptors .

  • Positive Selection: Bonobo TAS2Rs may reflect adaptive evolution to folivorous diets, though TAS2R66-specific data remain sparse .

Challenges and Future Directions

  • Ligand Identification: Physiological ligands for TAS2R66 are uncharacterized .

  • Crystallography: No resolved 3D structures exist; recombinant protein enables cryo-EM or X-ray studies .

References

  1. GPCRdb entry for Pan paniscus TAS2R3 (structural context) .

  2. Comparative analysis of TAS1R evolution in primates .

  3. Recombinant TAS2R46 production (methodology parallels) .

  4. Craniodental divergence in bonobo populations (ecological context) .

  5. TAS2R66 expression and purification .

  6. Phylogenomic insights into vertebrate TAS2Rs .

  7. Genomic selection in bonobos .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R66; Taste receptor type 2 member 66; T2R66
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
TAS2R66
Target Protein Sequence
MITFLPIIFSILIVVTFVIGNFANGFIALANSIEWFKRQKISFADQILTALAVPRVGLLW VLLLNWYATELNPAFYSIEVRITAYNLWAVINHFSNWLATSLSIFYLLKIANFSNLIFLR LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEGNMTWKIKLRSAMYLSNTTVT ILANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI YFVSVIISVWSFKNLENKPVFMFCQAIGFSCSSAHPFILIWGNKKLKQPFLSVLWQMRYW VKGEKPSSS
Uniprot No.

Target Background

Function
This receptor, potentially involved in the perception of bitterness and linked to gustducin, may play a role in sensing the chemical composition of the gastrointestinal content. Its activity may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R66 and what is its functional role in Pan paniscus?

TAS2R66 (Taste receptor type 2 member 66) is a transmembrane protein belonging to the bitter taste receptor family expressed in Pan paniscus (bonobo). These G-protein coupled receptors (GPCRs) mediate the detection of bitter compounds, potentially playing a crucial role in food selection and toxin avoidance behaviors. The receptor consists of 309 amino acids and functions as a chemosensory receptor that transduces signals from the extracellular environment to trigger intracellular signaling cascades . Similar to other T2R receptors, TAS2R66 likely contributes to taste perception, dietary preferences, and possibly digestive physiological responses in bonobos.

How does the sequence structure of TAS2R66 compare to other taste receptors in Pan paniscus?

TAS2R66 shares structural similarities with other taste receptor type 2 family members in Pan paniscus, such as TAS2R20. Both are characterized by seven transmembrane domains typical of GPCRs, though they differ in specific amino acid sequences. The TAS2R66 full-length protein comprises 309 amino acids with expression region 1-309, featuring a complex transmembrane topology . Comparatively, TAS2R20 (also known as TAS2R49) exhibits similar structural motifs but with distinct sequence variations that likely confer different ligand specificities and functional properties . These sequence divergences represent evolutionary adaptations potentially reflecting different bitter compound recognition profiles.

What expression systems are typically used for recombinant production of TAS2R66?

Recombinant Pan paniscus TAS2R66 is commonly expressed using in vitro Escherichia coli expression systems . This bacterial expression platform offers advantages including scalability, cost-effectiveness, and relatively high protein yields. The recombinant protein is typically engineered with an N-terminal 10xHis-tag to facilitate purification via affinity chromatography. Alternative expression systems that might be considered for comparative studies include yeast (Pichia pastoris or Saccharomyces cerevisiae), insect cells (Sf9 or High Five), or mammalian cell lines (HEK293 or CHO cells), particularly when post-translational modifications are critical for functional studies.

What are the optimal storage conditions for recombinant TAS2R66?

Recombinant TAS2R66 requires careful storage to maintain structural integrity and biological activity. The protein is typically available in liquid form or as lyophilized powder. For liquid preparations, storage at -20°C to -80°C is recommended, with aliquoting advised to avoid repeated freeze-thaw cycles that can compromise protein quality . Lyophilized preparations demonstrate extended shelf stability—generally up to 12 months at -20°C to -80°C compared to 6 months for liquid formulations. The buffer composition also influences stability, with Tris/PBS-based buffers containing 6% trehalose at pH 8.0 providing optimal conditions for maintaining protein structure and function .

What functional assays are appropriate for validating recombinant TAS2R66 activity?

Functional validation of recombinant TAS2R66 typically employs several complementary approaches:

  • Ligand binding assays: Using potential bitter compounds to measure binding affinity through techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

  • Calcium mobilization assays: Heterologous expression in cell lines with calcium-sensitive fluorescent dyes to monitor receptor activation upon ligand binding

  • Bioluminescence resonance energy transfer (BRET): To detect conformational changes and protein-protein interactions during receptor activation

  • Electrophysiological methods: Patch-clamp recordings in expression systems to measure channel activities coupled to receptor activation

These methodological approaches provide quantitative measurements of receptor functionality, allowing researchers to characterize ligand specificity, activation thresholds, and signal transduction properties.

How do evolutionary differences between Pan paniscus TAS2R66 and human TAS2R orthologs impact bitter taste perception?

Evolutionary analysis of TAS2R66 between Pan paniscus and humans reveals nuanced sequence variations that may influence bitter compound recognition profiles. While both species share significant sequence homology in taste receptor genes, reflecting their recent evolutionary divergence (approximately 6-8 million years), subtle amino acid substitutions in transmembrane domains and ligand-binding regions likely contribute to species-specific bitter taste perceptions. These molecular differences may correlate with dietary adaptations and food preference behaviors observed in comparative studies between bonobos and humans. Research methodologies addressing this question should combine sequence analysis, homology modeling, molecular dynamics simulations, and functional comparative assays using identical bitter compounds across species-specific receptors.

What are the methodological challenges in distinguishing TAS2R66 functional responses from other co-expressed taste receptors?

Isolating TAS2R66-specific responses presents significant experimental challenges due to potential co-expression of multiple taste receptor types in the same cells. Methodological approaches to address this challenge include:

  • CRISPR/Cas9 gene editing: Selective knockout of specific TAS2R receptors in cellular models to establish receptor-specific responses

  • Receptor-selective antagonists: Development and application of TAS2R66-specific blocking compounds to isolate receptor contributions

  • Single-cell transcriptomics: Correlation of receptor expression patterns with functional responses at the individual cell level

  • Heterologous expression systems: Expression of TAS2R66 in naive cell lines lacking endogenous taste receptors

  • Subtype-selective stimuli identification: Systematic screening to identify compounds that selectively activate TAS2R66 over other TAS2R family members

These methodologies require rigorous controls and validation to ensure the specificity of observed responses.

How does post-translational modification influence TAS2R66 trafficking and signaling efficiency?

Post-translational modifications (PTMs) significantly impact GPCR functionality, including membrane localization, ligand recognition, and signal transduction efficiency. For TAS2R66, potential PTMs include:

Modification TypePredicted SitesFunctional ImpactDetection Method
N-linked glycosylationN-terminal domainMembrane trafficking, stabilityGlycosidase treatment, lectin blotting
PhosphorylationIntracellular loops, C-terminusDesensitization, internalizationPhospho-specific antibodies, mass spectrometry
PalmitoylationCysteine residuesMembrane association, signaling complex formationClick chemistry, metabolic labeling
UbiquitinationLysine residuesDegradation, endocytic sortingUbiquitin pull-down, immunoblotting

Research approaches should employ site-directed mutagenesis of potential modification sites coupled with functional assays to correlate specific PTMs with receptor activity parameters. Mass spectrometry techniques provide comprehensive PTM mapping to guide these functional studies.

What are the critical considerations for designing ligand screening assays for TAS2R66?

Effective ligand screening for TAS2R66 requires careful experimental design addressing several key parameters:

  • Expression system selection: Choose between heterologous mammalian expression (more physiologically relevant) or specialized reporter cell lines (higher throughput)

  • Signal detection optimization: Select appropriate readouts (calcium flux, cAMP levels, β-arrestin recruitment) with optimal temporal resolution for transient GPCR responses

  • Compound library composition: Utilize structurally diverse bitter compounds, natural product extracts, and chemically modified derivatives to establish structure-activity relationships

  • Positive and negative controls: Include known bitter receptor agonists and non-target receptors to establish specificity profiles

  • Dose-response characterization: Employ multiple concentration points (typically 10^-9 to 10^-3 M) to determine EC50 values and efficacy parameters

The screening protocol should prioritize minimizing false positives through replicate testing and orthogonal validation assays, particularly for hits identified in primary screens.

How can researchers effectively optimize the solubility and stability of recombinant TAS2R66 for structural studies?

Obtaining stable, soluble preparations of transmembrane proteins like TAS2R66 for structural studies presents significant technical challenges. Methodological approaches include:

  • Construct optimization: Engineer truncated constructs removing flexible regions while preserving core transmembrane domains

  • Fusion partners: Incorporate stability-enhancing proteins (BRIL, T4 lysozyme) at terminal regions or intracellular loops

  • Detergent screening: Systematic evaluation of detergent classes (maltosides, glucosides, neopentyl glycols) for optimal extraction efficiency and stability

  • Lipid nanodisc incorporation: Reconstitution into defined lipid environments that better mimic native membrane conditions

  • Thermostability assays: Employ differential scanning fluorimetry to identify stabilizing conditions and ligands

Data from systematic stability screening should be organized in comparative tables tracking protein yield, monodispersity, and functional integrity across different preparation conditions.

How does TAS2R66 sequence and structure compare with TAS2R20 in Pan paniscus?

Comparative analysis of TAS2R66 and TAS2R20 in Pan paniscus reveals both conserved features and distinctive characteristics:

These sequence differences, particularly in the transmembrane domains and extracellular loops, likely contribute to differential bitter compound recognition profiles between these closely related receptors . Homology modeling and molecular dynamics simulations can provide further insights into how these sequence variations translate to structural differences affecting ligand specificity.

What methodological approaches can distinguish the functional roles of TAS2R66 from other taste receptors in behavioral studies?

  • Receptor-selective compounds: Identification and validation of TAS2R66-specific agonists through cell-based screening approaches

  • Conditional receptor knockout models: Development of tissue-specific and inducible TAS2R66 knockout systems to assess behavioral impacts

  • Two-bottle preference tests: Quantitative assessment of compound aversion with TAS2R66-specific ligands compared to broad bitter tastants

  • Lickometer analysis: High-temporal resolution measurement of licking patterns in response to TAS2R66 activators

  • Correlation of genetic variations with behavioral phenotypes: Identification of natural TAS2R66 polymorphisms in Pan paniscus populations and association with food preference variations

These methodologies should be implemented within ethically-approved frameworks for primate research, potentially utilizing non-invasive observational approaches where appropriate.

What are the critical gaps in current understanding of TAS2R66 function in Pan paniscus?

Despite available sequence information and expression capabilities, significant knowledge gaps remain regarding TAS2R66 in Pan paniscus. Current limitations include:

  • Incomplete characterization of natural ligands recognized by TAS2R66

  • Limited understanding of downstream signaling pathways and cellular responses

  • Unclear ecological relevance of TAS2R66 polymorphisms in wild bonobo populations

  • Insufficient comparative data between TAS2R66 and other primate orthologs

  • Lack of high-resolution structural information to guide targeted functional studies

Addressing these knowledge gaps requires interdisciplinary approaches combining molecular biology, biochemistry, behavioral ecology, and evolutionary genetics within a cohesive research framework.

What emerging technologies will advance TAS2R66 research in the coming years?

Several technological developments show particular promise for advancing TAS2R66 research:

  • Cryo-electron microscopy: Enabling high-resolution structural determination of membrane proteins without crystallization

  • Organoid taste bud models: Development of three-dimensional taste tissue cultures with physiologically relevant receptor expression patterns

  • Optogenetic and chemogenetic tools: Selective activation and inhibition of specific taste receptor pathways in vivo

  • Single-cell multi-omics: Integrated analysis of transcriptome, proteome, and functional responses at individual cell resolution

  • AI-powered computational modeling: Enhanced prediction of ligand-receptor interactions and structure-function relationships

These methodological advances will collectively enable more precise mechanistic understanding of TAS2R66 function, potentially leading to broader insights into taste perception evolution in primates and applications in comparative sensory biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.