Recombinant Pan paniscus Taste receptor type 2 member 8 (TAS2R8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Please note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
TAS2R8; Taste receptor type 2 member 8; T2R8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pan paniscus (Pygmy chimpanzee) (Bonobo)
Target Names
Target Protein Sequence
MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLIS VMVVNGIVIVLNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFL WLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKXPYF EPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSF IFFFFLYFISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQIFVRML TCRKIACVI
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is gustducin-linked. It could potentially be involved in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R8 and what is its role in the taste receptor family?

TAS2R8 belongs to the T2R family of G-protein coupled receptors that primarily mediate bitter taste perception. Like other members of the TAS2R family (such as TAS2R4 and TAS2R20), it functions as a chemosensory receptor that detects bitter compounds and transduces these signals through intracellular pathways. Within the evolutionary context, TAS2R8 in Pan paniscus likely serves similar functions to its homologs in related species, participating in the detection of potentially toxic bitter compounds as part of an evolved protective mechanism. The receptor is structurally characterized by seven transmembrane domains typical of GPCRs with specific binding sites for bitter ligands .

How do Pan paniscus TAS2R8 receptors compare structurally to other TAS2Rs?

TAS2R8 shares the typical structure of other TAS2R family members, consisting of seven transmembrane domains with extracellular and intracellular loops. Based on comparative analysis with other TAS2R proteins like TAS2R20, the receptor likely has an N-terminal domain, seven transmembrane helices (TM1-TM7), three extracellular loops (ECL1-3), three intracellular loops (ICL1-3), and a C-terminal domain . The amino acid sequence would determine specific binding properties, with variations in the transmembrane domains and extracellular loops particularly significant for ligand specificity.

What purification methods are most effective for recombinant TAS2R8?

Affinity chromatography using His-tag purification is a standard approach for TAS2R family proteins expressed with histidine tags, as demonstrated with TAS2R4 . The purification process typically involves:

  • Cell lysis under conditions that preserve protein structure

  • Affinity chromatography using Ni-NTA or similar matrices

  • Wash steps to remove non-specific binding

  • Elution with imidazole or pH gradient

  • Additional purification steps such as size exclusion chromatography

For membrane proteins like TAS2R8, detergent selection during extraction and purification is critical to maintain native-like folding and functionality.

How can one optimize functional assays to evaluate ligand binding to recombinant TAS2R8?

Functional characterization of TAS2R8 requires specialized assays that account for its GPCR nature. Recommended approaches include:

Calcium Mobilization Assays:

  • Heterologous expression of TAS2R8 in cell lines with G-protein coupling elements (typically using Gα16 or chimeric G-proteins)

  • Loading cells with calcium-sensitive fluorescent dyes

  • Measuring calcium flux upon ligand binding using fluorescence plate readers

  • Including positive controls with known bitter compounds and dose-response analysis

Receptor Internalization Assays:

  • Creating fluorescently-tagged TAS2R8 constructs

  • Tracking receptor movement using confocal microscopy upon ligand exposure

  • Quantifying internalization as a measure of receptor activation

For comprehensive functional analysis, these methods should be combined with molecular docking simulations to predict binding sites and guide mutagenesis studies for structure-function analysis .

What are the challenges in determining the three-dimensional structure of TAS2R8, and how might they be overcome?

Membrane proteins like TAS2R8 present significant structural determination challenges:

Key Challenges:

  • Low expression levels in recombinant systems

  • Instability when extracted from membrane environments

  • Difficulty in forming well-ordered crystals for X-ray crystallography

  • Conformational heterogeneity in solution

Potential Solutions:

  • Using thermostabilizing mutations identified through alanine scanning

  • Incorporating fusion proteins (e.g., T4 lysozyme, BRIL) to increase stability and crystallization propensity

  • Employing lipidic cubic phase crystallization techniques

  • Exploring cryo-electron microscopy as an alternative to crystallography

  • Using computational modeling validated by experimental constraints from mutagenesis and ligand binding studies

The sequence and structural information from related receptors like TAS2R20 can serve as templates for homology modeling approaches .

How do sequence variations in TAS2R8 among different Pan paniscus populations affect ligand specificity?

Population genetics of TAS2R8 in Pan paniscus remains an evolving research area. Analysis would involve:

  • Sampling from different bonobo populations to identify single nucleotide polymorphisms (SNPs) in the TAS2R8 gene

  • Expressing variant forms of TAS2R8 in heterologous systems

  • Conducting comparative binding and activation assays with a panel of bitter compounds

  • Correlating sequence variations with functional differences using statistical approaches

SNPs in transmembrane domains and ligand-binding regions would likely have more significant impacts on receptor function. This approach mirrors studies in human TAS2R38, where specific polymorphisms correlate with phenotypic variations in bitter taste perception, particularly for compounds like phenylthiocarbamide (PTC) .

What is the optimal experimental design for investigating TAS2R8 signaling pathway components in heterologous systems?

A comprehensive investigation of TAS2R8 signaling requires:

Expression System Design:

  • Co-expression of TAS2R8 with appropriate G-protein subunits (typically Gα-gustducin or chimeric G proteins)

  • Inclusion of downstream effectors like phospholipase C-β2 (PLC-β2)

  • Incorporation of the TRP channel TRPM5 for complete signaling reconstruction

Experimental Approaches:

  • BRET/FRET assays to monitor receptor-G protein coupling in real-time

  • Phosphorylation assays to track receptor desensitization

  • Electrophysiological measurements of channel activity

  • Pharmacological inhibition studies using specific pathway blockers

Data Analysis:

  • Kinetic modeling of signaling responses

  • Comparative analysis with other TAS2R family members

  • Correlation of structural features with signaling efficiency

What are the optimal storage and handling conditions for recombinant TAS2R8 protein?

Based on protocols for related TAS2R proteins, the following storage and handling recommendations apply:

Storage Conditions:

  • Store lyophilized protein at -20°C to -80°C

  • For reconstituted protein, store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles which significantly reduce activity

Reconstitution Protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Prepare small aliquots to minimize freeze-thaw cycles

How can researchers validate the functionality of recombinant TAS2R8 prior to experimental use?

Functional validation of recombinant TAS2R8 should include multiple approaches:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

  • Size exclusion chromatography to verify monodispersity

  • Western blotting to confirm intact protein and tag presence

Functional Validation Approaches:

  • Ligand binding assays using known bitter compounds that activate TAS2R family members

  • G-protein coupling assays in reconstituted systems

  • Thermal stability assays with and without ligands to assess proper folding

A multi-tiered validation approach ensures that experimental outcomes reflect the native functionality of the receptor rather than artifacts of recombinant production .

How does TAS2R8 compare functionally to other TAS2R family members in Pan paniscus?

TAS2R Family MemberAmino Acid LengthKey Structural FeaturesKnown LigandsSignaling Pathway
TAS2R42997TM domains, N-terminal His-tag viableVarious bitter compoundsGustducin-coupled, PLC-β2 activation
TAS2R8~300 (predicted)7TM domains, similar to other TAS2RsNot fully characterizedLikely gustducin-coupled
TAS2R20309Distinct ICL3 region, 7TM domainsSpecies-specific bitter compoundsSimilar to other TAS2Rs

The comparative analysis suggests TAS2R8 likely shares core structural and functional properties with other family members while potentially exhibiting unique ligand specificity profiles. The receptor would be expected to couple to similar G-protein pathways as other TAS2Rs, ultimately leading to calcium mobilization and taste signal transduction .

What approaches can address contradictory findings in TAS2R8 ligand screening studies?

When facing contradictory results in ligand screening:

  • Standardize Heterologous Expression Systems:

    • Use identical cell backgrounds across studies

    • Ensure consistent receptor expression levels through quantitative methods

    • Control for variations in G-protein coupling efficiency

  • Implement Dose-Response Characterization:

    • Test wide concentration ranges (typically 10⁻⁸ to 10⁻³ M)

    • Calculate EC₅₀ values rather than using single-point measurements

    • Account for potential allosteric effects between ligands

  • Cross-Validate with Multiple Assay Types:

    • Compare results between calcium mobilization, receptor internalization, and direct binding assays

    • Employ both cell-based and cell-free systems when possible

  • Control for Compound Properties:

    • Account for solubility limitations of hydrophobic bitter compounds

    • Monitor for non-specific effects at high concentrations

    • Verify compound purity through analytical methods

How can evolutionary analysis of TAS2R8 inform functional predictions?

Evolutionary analysis provides valuable insights for functional prediction:

  • Sequence Conservation Analysis:

    • Align TAS2R8 sequences across primate species

    • Identify highly conserved residues likely essential for structure or function

    • Map variable regions that may confer species-specific ligand preferences

  • Selection Pressure Calculation:

    • Calculate dN/dS ratios to identify sites under positive or negative selection

    • Correlate selection patterns with ecological adaptations and dietary preferences

    • Use statistical models to detect episodic selection events

  • Ancestral Sequence Reconstruction:

    • Infer ancestral TAS2R8 sequences

    • Express reconstructed proteins to determine functional shifts over evolutionary time

    • Correlate functional changes with dietary adaptations

  • Homology Modeling with Evolutionary Constraints:

    • Use evolutionary conservation patterns to guide structural modeling

    • Predict ligand binding sites based on variability patterns

    • Design mutagenesis experiments targeting evolutionarily interesting residues

What emerging technologies might advance TAS2R8 research beyond current methodological limitations?

Several cutting-edge approaches show promise for TAS2R research:

  • Cryo-EM for Membrane Protein Structural Determination:

    • Recent advances allow structure determination of smaller membrane proteins

    • Single-particle analysis combined with novel detergents or nanodiscs

    • Potential for capturing multiple conformational states

  • Organoid Systems for Native Context Studies:

    • Development of taste bud organoids expressing native levels of taste receptors

    • More physiologically relevant than heterologous systems

    • Potential for studying cell-cell interactions in taste signaling

  • CRISPR-Cas9 Gene Editing in Model Organisms:

    • Creation of humanized or "bonobized" mouse models with Pan paniscus TAS2R8

    • Precise mutation introduction to study specific receptor variants

    • In vivo behavioral studies correlating receptor function with perception

  • Artificial Intelligence for Ligand Discovery:

    • Machine learning approaches to predict novel TAS2R8 ligands

    • Virtual screening of compound libraries

    • Structure-based drug design for taste modulators

How might TAS2R8 research contribute to understanding broader taste perception differences between humans and other primates?

TAS2R8 research offers several avenues for comparative taste biology:

  • Ecological Adaptation Insights:

    • Correlation between TAS2R8 ligand specificity and dietary adaptations

    • Understanding evolutionary pressures that shaped taste perception

    • Identifying plant secondary compounds that drove receptor diversification

  • Molecular Basis of Species-Specific Taste Preferences:

    • Comparing orthologous receptors across primate species

    • Identifying key amino acid substitutions responsible for altered ligand profiles

    • Reconstructing evolutionary history of taste perception changes

  • Translational Applications:

    • Development of species-specific taste modulators

    • Understanding human-specific taste adaptations

    • Potential applications in food science and anthropology

  • Methodological Framework:

    • TAS2R8 research establishes protocols applicable to other taste receptors

    • Creating a comprehensive model of primate taste evolution

    • Developing tools for predicting receptor-ligand interactions across species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.