Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

  • Gene Name: HTR1B (5-hydroxytryptamine receptor 1B)

  • Protein Name: 5-HT1B receptor (Serotonin receptor 1B)

  • Species Origin: Pan troglodytes (Chimpanzee)

  • UniProt ID: P60020

Expression Systems

Host SystemPurityTagApplication
E. coli≥85% (SDS-PAGE)His-tagBinding assays
Mammalian cells≥85% (SDS-PAGE)NoneFunctional studies
Baculovirus/Insect cells≥85% (SDS-PAGE)SUMO, GSTStructural analysis
Data from .

Biological Role

  • Mediates serotonin (5-HT) signaling, modulating neurotransmission, vascular tone, and behavioral responses .

  • Acts as an autoreceptor (presynaptic) and heteroreceptor (postsynaptic) in the CNS .

Key Functional Regions

  • 5′ Regulatory Region: Polymorphisms (e.g., rs1778258, rs1228814) alter transcriptional activity by creating/abolishing transcription factor binding sites .

  • 3′ Regulatory Region: Variations (e.g., rs6297) inhibit gene expression in neuronal cell lines .

Ligand Interactions

LigandAffinity (nM)EffectCell Model
Serotonin (5-HT)1–10Full agonistSK-N-SH, HEK-293
RU2496950–100Partial agonistTransgenic mouse brain
BRL-15572155-HT1D-selective antagonistHuman brain tissue
Data from .

Transcriptional Regulation Studies

  • Haplotype Effects:

    • Haplotype H6 (rs17273700-C/rs11568817-G) enhances transcriptional activity by 40% compared to H3 in HEK-293 cells .

    • rs1778258-A reduces promoter activity, correlating with psychiatric disorder susceptibility .

Pathophysiological Correlations

  • Linked to schizophrenia, migraines, and aggression in transgenic mouse models .

  • Migraine Mechanism: Mediates cranial vasoconstriction via 5-HT1B activation, mimicking human therapeutic responses .

Comparative Species Analysis

  • Human vs. Chimpanzee HTR1B:

    • 98% sequence homology, but pharmacological differences exist (e.g., RU24969 has lower affinity for humanized receptors) .

    • Functional coupling to G-proteins preserved across species .

Assay Compatibility

  • Western Blot: Anti-5HT1B antibodies validated in human, mouse, and rat samples .

  • [35S]GTPγS Binding: Confirms G-protein coupling in brain sections .

Clinical and Therapeutic Implications

  • Drug Targeting: 5-HT1B agonists (e.g., sumatriptan) used for migraine treatment .

  • Behavioral Studies: HTR1B-knockout mice exhibit increased aggression and cocaine vulnerability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
HTR1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Uniprot No.

Target Background

Function
This is the G-protein coupled receptor for 5-hydroxytryptamine (serotonin). It also acts as a receptor for various alkaloids and psychoactive substances. Ligand binding triggers a conformational change, initiating signaling through guanine nucleotide-binding proteins (G proteins) and modulating the activity of downstream effectors, such as adenylate cyclase. The signaling process inhibits adenylate cyclase activity. Members of the arrestin family inhibit signaling via G proteins and mediate activation of alternative signaling pathways. This receptor regulates the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, thereby affecting neural activity, nociceptive processing, pain perception, mood, and behavior. Additionally, it plays a role in vasoconstriction of cerebral arteries.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pan troglodytes 5-hydroxytryptamine receptor 1B and its significance in neuroscience?

Pan troglodytes 5-hydroxytryptamine receptor 1B (HTR1B) is a G-protein coupled receptor that mediates serotonergic neurotransmission in chimpanzees. This receptor belongs to the broader 5-HT receptor family, which plays crucial roles in regulating various physiological and behavioral processes in primates. The receptor is also known by alternative nomenclature including 5-HT-1B, 5-HT1B, and Serotonin receptor 1B . As a key component of the serotonergic system, HTR1B is involved in modulating neural circuits associated with mood regulation, cognitive function, and other complex behaviors in primates. Research on Pan troglodytes HTR1B provides valuable insights into the evolutionary conservation and divergence of serotonergic systems across primate lineages, particularly in comparison to human HTR1B variants.

What expression systems are most effective for producing recombinant Pan troglodytes HTR1B?

Multiple expression systems have proven effective for producing recombinant Pan troglodytes HTR1B, each offering distinct advantages depending on research objectives. The most commonly employed systems include E. coli, yeast, baculovirus, mammalian cell lines, and cell-free expression systems . For structural studies requiring high protein yield, E. coli and yeast systems may be preferable, though they often struggle with proper post-translational modifications. Baculovirus and mammalian expression systems provide superior post-translational modifications, critical for functional studies of G-protein coupled receptors like HTR1B. Cell-free expression systems have emerged as an efficient alternative, particularly for rapid production of HTR1B with specific tags for purification and detection purposes . When selecting an expression system, researchers should consider downstream applications, required protein purity (typically ≥85% as determined by SDS-PAGE), and whether post-translational modifications are essential to their experimental design.

How is the purity of recombinant Pan troglodytes HTR1B validated?

The validation of recombinant Pan troglodytes HTR1B purity involves multiple analytical techniques, with SDS-PAGE serving as the primary quality control method. Standard recombinant HTR1B preparations should achieve purity greater than or equal to 85% as determined by SDS-PAGE analysis . Beyond gel electrophoresis, Western blotting using specific antibodies against HTR1B or attached purification tags (such as Strep Tag) provides additional verification of protein identity and integrity . For applications requiring higher purity standards, additional chromatographic techniques may be employed, including size-exclusion chromatography to eliminate aggregates and affinity chromatography to capture specifically tagged HTR1B proteins. Mass spectrometry analysis can further confirm protein identity and detect potential post-translational modifications or degradation products that might affect functional studies.

What functional assays are most informative for characterizing recombinant Pan troglodytes HTR1B activity?

Comprehensive functional characterization of recombinant Pan troglodytes HTR1B requires multiple complementary assays targeting different aspects of receptor biology. G-protein coupling assays using [35S]GTPγS binding or BRET/FRET-based approaches can quantify receptor activation upon ligand binding. Second messenger assays measuring cAMP inhibition (as HTR1B couples primarily to Gi/o proteins) provide insights into downstream signaling efficiency. Radioligand binding studies using tritiated ligands (such as [3H]5-HT or [3H]GR125743) enable determination of binding affinities and receptor densities. Calcium flux assays using fluorescent calcium indicators can assess crosstalk with calcium signaling pathways. For more complex functional characterization, electrophysiological approaches in HTR1B-expressing cells or tissues can measure the receptor's influence on neuronal excitability. Researchers should incorporate positive controls using well-characterized HTR1B ligands and negative controls with selective antagonists to validate assay specificity, particularly when differentiating HTR1B activity from other 5-HT receptor subtypes that may share ligands.

How do polymorphisms in Pan troglodytes HTR1B compare to those identified in other primates?

Genetic variation in serotonin receptor genes plays a significant role in behavioral phenotypes across primate species. While specific polymorphisms in Pan troglodytes HTR1B are less documented compared to HTR1A, research on related serotonin receptors provides valuable context. In chimpanzees, the HTR1A gene shows evidence of positive selection at a specific amino acid substitution site (Thr26Ser), suggesting evolutionary importance . Comparatively, the related HTR1A receptor in chimpanzees exhibits a functional C/A single nucleotide polymorphism changing proline to glutamine (Pro248Gln) in the third intracellular loop, a region critical for serotonin signal transduction . This polymorphism is associated with reduced anxiety, decreased male agonistic behavior, and increased socio-positive behavior . By analogy, polymorphisms in HTR1B might similarly influence behavioral phenotypes in chimpanzees, though specific studies on HTR1B variations are needed. The evolutionary conservation of serotonergic signaling components across primates suggests that HTR1B polymorphisms might affect similar behavioral domains, potentially including aggression regulation, anxiety, and social behavior.

What are the key considerations when designing experiments to study Pan troglodytes HTR1B signaling pathways?

Designing robust experiments to investigate Pan troglodytes HTR1B signaling requires careful consideration of receptor biology, experimental controls, and technical limitations. First, researchers must ensure specific targeting of HTR1B without cross-reactivity with other 5-HT receptors, particularly HTR1A and HTR1D, which share significant pharmacological profiles. This can be achieved using highly selective ligands and antagonists, or through genetic approaches with receptor-specific knockdown. Second, the experimental system must maintain physiologically relevant receptor expression levels, as both over-expression and under-expression can distort signaling dynamics. Third, researchers should account for potential species-specific differences when using non-chimpanzee components (e.g., G-proteins from different species) in reconstituted systems. Fourth, temporal aspects of signaling should be considered, including receptor desensitization, internalization, and recycling, which may affect experimental outcomes in prolonged studies. Finally, integration of multiple readouts (e.g., G-protein activation, cAMP inhibition, ERK phosphorylation) provides a more comprehensive understanding of signaling pathways than single endpoint measurements.

How can comparative neuropharmacology approaches inform our understanding of Pan troglodytes HTR1B function?

Comparative neuropharmacology offers powerful insights into the evolutionary conservation and divergence of HTR1B function across species. Triptans, a class of antimigraine drugs that act as HTR1B agonists, provide an exemplary case for such comparative approaches. In mice, triptans like frovatriptan have been shown to suppress appetite and reduce body weight in diet-induced obese models through activation of serotonin 1B receptors (Htr1b) . Specifically, Htr1b in AgRP neurons within the arcuate nucleus of the hypothalamus contributes to the hypophagic effects of HTR1B agonists . Comparative studies could determine whether Pan troglodytes HTR1B exhibits similar physiological roles in appetite regulation. By systematically comparing ligand binding profiles, signaling responses, and physiological outcomes across species (human, chimpanzee, and rodent models), researchers can identify conserved functional domains and species-specific adaptations in HTR1B biology. Such comparative approaches are particularly valuable for translational research aiming to develop therapeutics targeting serotonergic systems.

What purification strategies optimize yield and functionality of recombinant Pan troglodytes HTR1B?

Optimizing purification of recombinant Pan troglodytes HTR1B requires balancing yield, purity, and preservation of functional integrity. A multi-step purification strategy typically begins with affinity chromatography utilizing fusion tags such as Strep Tag, which allows specific capture of the target protein . For membrane proteins like HTR1B, detergent selection is critical - mild detergents like DDM, LMNG, or digitonin help solubilize the receptor while maintaining its native conformation. Following initial capture, size-exclusion chromatography separates monomeric receptor from aggregates and other contaminants. Throughout purification, buffer composition should be carefully optimized to stabilize the receptor, potentially including cholesterol or other lipids that mimic the native membrane environment. For functional studies, reconstitution into nanodiscs, liposomes, or detergent micelles may better preserve activity compared to detergent-solubilized preparations. Quality control checkpoints should be implemented at each purification stage, with final preparations achieving ≥85% purity as determined by SDS-PAGE .

What are the most effective approaches for studying Pan troglodytes HTR1B in neuronal contexts?

Studying Pan troglodytes HTR1B in neuronal contexts presents unique challenges that require specialized approaches. Since direct experimentation on chimpanzee neural tissue is ethically and practically limited, several alternative strategies have been developed. Induced pluripotent stem cells (iPSCs) derived from chimpanzee fibroblasts can be differentiated into neurons expressing endogenous HTR1B, providing a species-authentic cellular context. Alternatively, CRISPR/Cas9 gene editing can be used to "humanize" rodent models by replacing mouse Htr1b with the Pan troglodytes ortholog. For circuit-level studies, viral vectors expressing Pan troglodytes HTR1B can be introduced into specific brain regions in animal models. Drawing parallels from studies of mouse Htr1b, researchers investigating chimpanzee HTR1B should consider region-specific effects - for instance, Htr1b in AgRP neurons in the arcuate nucleus of the hypothalamus contributes to appetite regulation , while Htr1b in other brain regions may serve different functions. Specialized genetic tools, such as conditional expression systems like the Htr1b-Cre mice developed for rodent studies , could be adapted for investigating chimpanzee HTR1B.

How can researchers effectively compare pharmacological profiles between human and Pan troglodytes HTR1B?

Comparative pharmacological profiling of human and Pan troglodytes HTR1B provides crucial insights for translational research and evolutionary pharmacology. A systematic approach begins with parallel expression of both orthologs in identical cellular backgrounds to minimize confounding variables. Radioligand competition binding assays using a panel of ligands (agonists, antagonists, and allosteric modulators) can reveal potential species differences in binding pocket structure. Functional assays measuring multiple signaling outputs (G-protein activation, β-arrestin recruitment, cAMP modulation) can identify biased signaling differences between species. Molecular dynamics simulations based on receptor structures can predict ligand binding modes and explain observed pharmacological differences. The table below illustrates a framework for systematic pharmacological comparison:

ParameterAssay TypeHuman HTR1BPan troglodytes HTR1BSignificance of Differences
Binding AffinityRadioligand CompetitionKi values for key ligandsKi values for key ligandsDifferences suggest binding pocket variations
G-protein Coupling[35S]GTPγS BindingEC50/Emax valuesEC50/Emax valuesDifferences in signaling efficiency
Arrestin RecruitmentBRET/FRET AssaysRecruitment kineticsRecruitment kineticsDifferences in desensitization pathways
Receptor DesensitizationPhosphorylation AssaysTime course analysisTime course analysisRegulatory mechanism variations
Response to TriptanscAMP InhibitionPotency (EC50) valuesPotency (EC50) valuesTherapeutic relevance for migraine treatment

This systematic comparison framework allows researchers to identify subtle pharmacological differences that might have significant implications for drug development and understanding species-specific responses to serotonergic compounds.

How might Pan troglodytes HTR1B function in appetite regulation compared to rodent models?

Recent research has identified a novel role for serotonin 1B receptors in appetite regulation, presenting an intriguing direction for comparative studies involving Pan troglodytes HTR1B. In mice, triptans (medications commonly used for migraines) have been shown to suppress appetite through activation of the serotonin 1B receptor (Htr1b) . Specifically, frovatriptan treatment reduces food intake and body weight in diet-induced obese mice, with the anorectic effect depending on Htr1b . The mechanism involves Htr1b in AgRP neurons within the arcuate nucleus of the hypothalamus, which contributes to the hypophagic effects of HTR1B agonists . Whether Pan troglodytes HTR1B functions similarly in appetite regulation remains an open question. Comparative studies could explore how the AgRP neuron-specific expression of HTR1B differs between chimpanzees and mice, potentially revealing evolutionary adaptations in feeding regulation circuits. Such research could inform both basic understanding of primate metabolic regulation and potential therapeutic applications for human metabolic disorders, given the closer evolutionary relationship between chimpanzees and humans.

What role might Pan troglodytes HTR1B play in regulating social behavior and anxiety?

The potential role of Pan troglodytes HTR1B in regulating social behavior and anxiety represents a fascinating but underexplored research area. Studies on the related serotonin receptor HTR1A provide compelling evidence for serotonergic involvement in primate social behavior. In chimpanzees, polymorphic variation in the HTR1A gene has been associated with anxiety reduction, decreased rates of male agonistic behavior, and increased socio-positive behavior . Specifically, a Pro248Gln substitution located in the third intracellular loop of the receptor - a region important for serotonin signal transduction - appears to influence these behavioral traits . Given the functional similarity and evolutionary relationship between HTR1A and HTR1B, it is reasonable to hypothesize that HTR1B might similarly influence social behavior in chimpanzees. The investigation of potential HTR1B polymorphisms in chimpanzee populations, coupled with behavioral observations, could reveal whether this receptor also contributes to the regulation of social interactions. Such research would provide valuable insights into the evolutionary basis of serotonergic regulation of complex social behaviors in primates.

How can advanced genetic tools enhance the study of Pan troglodytes HTR1B in neural circuits?

The application of cutting-edge genetic tools to study Pan troglodytes HTR1B neural circuits represents a frontier in primate neuroscience research. Drawing inspiration from rodent studies, where the development of Htr1b-Cre mice has enabled bidirectional regulation of food intake through manipulation of Htr1b-expressing neurons , similar approaches could be adapted for chimpanzee models. While direct genetic manipulation in chimpanzees faces ethical and practical limitations, alternative approaches include: (1) creating "chimeric" in vitro models where chimpanzee HTR1B is expressed in defined neural circuits; (2) using single-nucleus RNA sequencing to identify the transcriptional signature of HTR1B-expressing neurons in preserved chimpanzee brain tissue, similar to how this approach revealed that Htr1b marks a subset of AgRP neurons in mice ; and (3) developing viral vectors carrying chimpanzee HTR1B under the control of cell-type-specific promoters for studies in appropriate model systems. These approaches would allow researchers to investigate how Pan troglodytes HTR1B contributes to specific neural circuit functions while respecting ethical considerations in primate research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.