Recombinant Pan troglodytes 5-hydroxytryptamine receptor 2C (HTR2C)

Shipped with Ice Packs
In Stock

Description

Functional Roles

HTR2C mediates serotonin’s effects through Gq/11-coupled signaling, activating phospholipase C and intracellular calcium pathways . Key functional aspects include:

  • Neurotransmission Modulation: Regulates dopamine and norepinephrine release in brain regions like the striatum and prefrontal cortex .

  • Pathway Involvement: Participates in calcium signaling, serotonergic synapse activity, and neuroactive ligand-receptor interactions .

  • Disease Relevance: Altered RNA editing patterns linked to depression, obesity, and drug abuse .

PathwayRole of HTR2CAssociated Proteins
Calcium SignalingModulates intracellular calcium levelsCAMK2D1, PHKA2, RYR3
Serotonergic SynapseRegulates synaptic plasticityTPH1, HTR3E, GNAQ
Neuroactive Ligand InteractionBinds serotonin and ligandsGRM6, TAAR14B, EDNRA

Research Applications

Recombinant Pan troglodytes HTR2C is utilized in comparative studies to explore interspecies differences in receptor function. Applications include:

Drug Development

  • Antidepressants/Antipsychotics: Testing compounds like agomelatine (5-HT2C antagonist) and mirtazapine .

  • Obesity Therapies: Exploring 5-HT2C agonists to regulate feeding behavior .

ApplicationMethodExample Compounds
Ligand Binding AssaysRadioligand displacement, FRETErgotamines, SSRIs (e.g., fluoxetine)
Signaling Pathway StudiesCalcium influx assays, GTPγS bindingAgonists (e.g., m-chlorophenylpiperazine)

Comparative Insights

While direct data on Pan troglodytes HTR2C is sparse, cross-species comparisons highlight conserved and divergent features:

SpeciesKey DifferencesShared Features
Human X-chromosome localization; RNA editing linked to depressionGq/11 coupling, dimerization
Rat High expression in hippocampus and amygdalaSimilar structural motifs
Pan troglodytesLimited data; inferred from homologyPresumed RNA editing sites

Challenges and Future Directions

  • RNA Editing Complexity: Variability in editing patterns across species complicates functional predictions .

  • Species-Specific Studies: Direct characterization of Pan troglodytes HTR2C is needed to validate homology-based assumptions.

  • Therapeutic Implications: Leveraging chimpanzee models to refine drug efficacy and toxicity profiles.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR2C; 5-hydroxytryptamine receptor 2C; 5-HT-2C; 5-HT2C; 5-HTR2C; Serotonin receptor 2C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI VVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA ISIGVSVPIPVIGLRDERKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Uniprot No.

Target Background

Function
This G-protein coupled receptor recognizes 5-hydroxytryptamine (serotonin). It also acts as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding induces a conformational change, triggering signaling through guanine nucleotide-binding proteins (G proteins) and modulating the activity of downstream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate the activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system, which modulates the activity of phosphatidylinositol 3-kinase and downstream signaling cascades, ultimately promoting the release of Ca(2+) ions from intracellular stores. This receptor regulates neuronal activity by activating short transient receptor potential calcium channels in the brain. Consequently, it modulates the activation of pro-opiomelacortin neurons and the release of CRH, further regulating corticosterone release. HTR2C plays a crucial role in regulating appetite and feeding behavior, responses to anxiogenic stimuli and stress. It is also involved in insulin sensitivity and glucose homeostasis.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Pan troglodytes 5-Hydroxytryptamine Receptor 2C (HTR2C)?

Recombinant Pan troglodytes 5-Hydroxytryptamine Receptor 2C (HTR2C) is a protein expressed from the cloned gene of the chimpanzee (Pan troglodytes) serotonin 2C receptor. The receptor belongs to the G protein-coupled receptor (GPCR) family and plays key roles in serotonergic neurotransmission. Similar to its human ortholog, the chimpanzee HTR2C is involved in various physiological processes including appetite regulation, mood control, and anxiety responses. The recombinant form allows detailed study of the receptor's structure, function, and pharmacology in controlled laboratory environments.

The complete amino acid sequence of Pan troglodytes HTR2C is provided in product information resources, showing the protein's primary structure which includes seven transmembrane domains characteristic of GPCRs . This sequence information is critical for designing experimental manipulations, including site-directed mutagenesis studies and epitope tagging. The recombinant protein enables researchers to study HTR2C in isolation from other cellular components that might influence its behavior in native tissue, providing controlled experimental conditions for pharmacological characterization and signaling studies.

How does HTR2C differ from other 5-HT receptor subtypes?

The 5-hydroxytryptamine (5-HT) receptor family comprises fourteen molecularly distinct receptor subtypes that regulate diverse physiological and behavioral responses . HTR2C belongs to the 5-HT2 subfamily, which also includes 5-HT2A and 5-HT2B. While these receptors share structural similarities, they differ significantly in their distribution patterns, pharmacological profiles, and physiological roles.

In terms of tissue distribution, HTR2C is predominantly expressed in the choroid plexus, cerebral cortex, hippocampus, and substantia nigra, whereas HTR2A is more broadly distributed in neocortex, caudate nucleus, and vascular tissue . While both HTR2A and HTR2C primarily couple to Gq/11 proteins activating phospholipase C pathways, they exhibit different constitutive activity levels and desensitization patterns. Unlike HTR2A, which has been implicated in obsessive-compulsive disorder and major depressive disorder, HTR2C is more strongly associated with feeding behavior, obesity, and certain aspects of psychotic disorders .

A unique feature of HTR2C is its ability to undergo RNA editing, a post-transcriptional modification that can generate up to 24 protein isoforms with varying G-protein coupling efficiencies. This characteristic is not shared by all 5-HT receptors and represents an additional regulatory mechanism specific to HTR2C function.

What expression systems are commonly used for producing Recombinant Pan troglodytes HTR2C?

Several expression systems can be employed for producing recombinant HTR2C, each offering specific advantages depending on the research objectives:

  • Mammalian cell lines: HEK293, CHO, and COS-7 cells provide appropriate post-translational modifications and cellular machinery for proper GPCR folding and trafficking. The 5-HT1A receptor has been successfully expressed in these systems, demonstrating the viability of this approach for serotonin receptors . These systems are preferred when studying receptor trafficking, signal transduction pathways, or conducting high-throughput screening assays.

  • Insect cell systems: Baculovirus-infected Sf9 or High Five insect cells can produce higher yields of functional GPCR proteins compared to mammalian systems. These systems are particularly useful for structural biology studies requiring larger protein quantities.

  • Yeast expression systems: Saccharomyces cerevisiae and Pichia pastoris provide cost-effective alternatives for large-scale production, though with glycosylation patterns that differ from mammalian cells.

  • Cell-free expression systems: These enable rapid production of the receptor for structural studies without cellular constraints.

The choice of expression system should be guided by the specific research application, considering factors such as post-translational modifications, protein yield, and functional coupling to downstream signaling pathways. For comparative studies between chimpanzee and human HTR2C, consistent expression in identical systems is crucial to ensure valid comparisons.

How can I verify the functionality of recombinant HTR2C in experimental systems?

Verifying the functionality of recombinant HTR2C requires multiple complementary approaches to assess different aspects of receptor biology:

  • Ligand binding assays: Radioligand competition and saturation binding assays using known 5-HT2C ligands confirm the receptor's ability to bind its natural and synthetic ligands. These assays determine receptor density (Bmax) and binding affinity (Kd) values.

  • G-protein coupling assays: Functional coupling to G proteins can be evaluated by measuring second messenger responses such as calcium mobilization, inositol phosphate production, or ERK phosphorylation following agonist stimulation. For 5-HT receptors, these signaling pathways have been well-characterized in recombinant systems .

  • GTPγS binding assays: These measure the receptor's ability to catalyze nucleotide exchange on G proteins upon agonist stimulation, providing a proximal readout of receptor activation.

  • Receptor internalization studies: Fluorescently tagged receptors can be monitored for internalization following agonist exposure using confocal microscopy or flow cytometry.

  • Electrophysiological measurements: In appropriate expression systems, patch-clamp techniques can measure ion channel activity modulated by HTR2C activation.

Each verification method addresses different aspects of receptor functionality, from ligand recognition to downstream signaling. Including known positive controls (e.g., reference agonists) and negative controls (e.g., structurally related but inactive compounds) is essential for validating assay performance and receptor functionality.

How can Recombinant Pan troglodytes HTR2C be used in comparative studies with human HTR2C?

Recombinant Pan troglodytes HTR2C provides a valuable tool for comparative studies with human HTR2C due to the evolutionary proximity between chimpanzees and humans. These studies can reveal insights about receptor evolution, species-specific drug responses, and conserved functional mechanisms:

  • Pharmacological profiling: Parallel characterization of both receptors with diverse ligand panels can identify species-specific pharmacological differences. Comparing binding affinities, potencies, and efficacies across multiple compounds builds comprehensive pharmacological profiles for both receptors.

  • Signaling pathway comparison: Systematic analysis of G-protein coupling efficiency, β-arrestin recruitment, and downstream signaling activation can reveal subtle species differences in signal transduction mechanisms. This approach was successfully applied to other 5-HT receptors, revealing complex signaling networks .

  • RNA editing analysis: Both human and chimpanzee HTR2C undergo RNA editing at multiple sites, but comparative analysis can reveal species differences in editing efficiency and the resulting receptor isoform distribution. These differences may reflect species-specific adaptations in serotonergic system regulation.

  • Receptor regulation comparison: Side-by-side analysis of receptor desensitization, internalization, and trafficking can identify species-specific regulatory mechanisms. This is particularly important when evaluating the suitability of animal models for psychiatric disorders involving serotonergic dysregulation.

Such comparative studies not only illuminate evolutionary aspects of serotonergic system development but can also help explain species differences in drug responses that may be relevant for translational research and drug development.

What are the methodological considerations for studying HTR2C heterodimerization?

Investigating HTR2C heterodimerization requires specialized techniques that can detect and characterize protein-protein interactions in membrane environments. Based on research with related receptors like 5-HT1A forming heterodimers with orexin receptors , several methodological approaches are particularly relevant:

  • Co-immunoprecipitation (Co-IP): This technique can identify protein-protein interactions by precipitating HTR2C and then detecting potential dimer partners in the precipitate. For membrane proteins like HTR2C, careful optimization of detergent conditions is crucial to maintain native interactions while solubilizing receptors effectively.

  • Resonance energy transfer techniques: Both FRET (Fluorescence Resonance Energy Transfer) and BRET (Bioluminescence Resonance Energy Transfer) can detect close physical interactions between tagged proteins. These approaches have been successfully applied to study 5-HT receptor dimerization, providing real-time monitoring of interactions in living cells.

  • Proximity ligation assay (PLA): This technique visualizes protein interactions with single-molecule resolution in fixed cells or tissues, offering advantages for detecting native receptor interactions without overexpression.

  • Mass spectrometry approaches: As demonstrated for 5-HT1AR/OX1R heterodimers, mass spectrometry can identify interaction interfaces between receptors . This approach requires careful sample preparation to maintain membrane protein complexes during analysis.

  • Transmembrane domain peptide studies: Peptides corresponding to specific transmembrane domains can be used to disrupt heterodimer formation, as shown for 5-HT1AR/OX1R heterodimers using HIV TAT-fused peptides . This approach can confirm specific interaction sites and provide insights into the functional consequences of disrupting dimerization.

To avoid artifacts, multiple complementary techniques should be employed, with appropriate controls including non-dimerizing receptor pairs and validation in physiologically relevant expression systems.

How can I design experiments to study the role of HTR2C in neuropsychiatric disorders using recombinant receptors?

Designing experiments to investigate HTR2C's role in neuropsychiatric disorders using recombinant receptors requires a multi-faceted approach that bridges molecular pharmacology with disease relevance:

  • Receptor variant studies: Generate recombinant receptors carrying disease-associated single nucleotide polymorphisms (SNPs) or RNA editing profiles to examine their functional consequences on signaling, ligand binding, and receptor regulation. This approach has been productive for understanding how 5-HT receptor variations influence depression and other disorders .

  • Signal transduction analysis: Compare signaling pathway activation between wild-type and variant receptors, focusing on pathways implicated in neuropsychiatric conditions. Multiple readouts should be measured, including calcium signaling, phosphoinositide hydrolysis, and ERK activation, as single receptors can couple to multiple signaling pathways .

  • Pharmacological profiling: Evaluate how clinically used antipsychotics, antidepressants, or novel compounds interact with wild-type versus variant receptors. This can reveal mechanisms underlying individual differences in treatment response and side effect profiles.

  • Co-expression systems: Reconstitute the receptor with other proteins implicated in psychiatric disorders to study potential interactions and their effects on signaling. The formation of heterodimers, as shown with other serotonin receptors , may be particularly relevant to disease mechanisms.

  • Cellular model integration: Express the receptor in induced pluripotent stem cell (iPSC)-derived neurons from patients with psychiatric disorders to examine receptor function in a disease-relevant cellular context with appropriate signaling machinery.

These approaches should incorporate both acute and chronic drug treatments to model therapeutic interventions, with careful attention to concentrations that reflect clinically relevant exposures.

What techniques are available for studying HTR2C post-translational modifications and their functional consequences?

Post-translational modifications (PTMs) can significantly alter HTR2C function, and several specialized techniques can characterize these modifications and their effects:

  • Mass spectrometry approaches: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify and quantify multiple PTMs including phosphorylation, glycosylation, and palmitoylation. This technique provides site-specific information about modification stoichiometry and can detect previously unknown modifications.

  • Site-directed mutagenesis: Mutating potential modification sites (e.g., changing serine to alanine to prevent phosphorylation) followed by functional assays can reveal the importance of specific PTMs for receptor function. This approach has been productive for understanding regulation of related receptors like 5-HT1A .

  • Phospho-specific antibodies: For studying phosphorylation, antibodies that specifically recognize phosphorylated forms of the receptor enable detection of modification status through Western blotting, immunofluorescence, or flow cytometry.

  • Metabolic labeling: Incorporation of radioactive or chemically modified precursors can track modifications like palmitoylation ([3H]palmitate) or glycosylation ([3H]mannose) in pulse-chase experiments, revealing the dynamics of receptor modification.

  • Inhibitor studies: Pharmacological inhibitors of kinases, glycosylation enzymes, or other modification machinery can help determine which enzymes are responsible for specific modifications and their functional consequences.

  • Conformation-specific nanobodies or antibodies: These tools can detect specific receptor conformations that may be stabilized by particular PTMs, providing insights into how modifications affect receptor structure.

Functional consequences should be assessed through comprehensive characterization including ligand binding parameters, signaling pathway activation, receptor trafficking, and protein-protein interactions to fully understand how PTMs regulate HTR2C biology.

What are the optimal storage and handling conditions for recombinant HTR2C to maintain functionality?

Proper storage and handling of recombinant HTR2C is critical for maintaining its structural integrity and functionality throughout experimental procedures. Based on established protocols and product information, the following conditions are recommended:

  • Storage temperature: Store at -20°C for regular use, or at -80°C for extended storage periods to minimize protein degradation . The choice depends on anticipated usage frequency and storage duration.

  • Buffer composition: Recombinant HTR2C is typically stored in Tris-based buffer with 50% glycerol, which helps maintain protein stability by preventing freeze-damage and providing a stabilizing environment . The precise buffer composition may need optimization based on downstream applications.

  • Freeze-thaw management: Repeated freezing and thawing should be strictly avoided as it leads to protein denaturation and aggregation. Instead, prepare small working aliquots upon first thaw and store them separately to minimize freeze-thaw cycles .

  • Working temperature: When conducting experiments, maintain the protein at 4°C whenever possible to minimize degradation. This is particularly important during lengthy procedures like binding assays or solubilization steps.

  • Protease inhibition: Adding protease inhibitor cocktails is advisable during experimental manipulations to prevent degradation, especially when working with cell lysates or membrane preparations.

  • Detergent considerations: As a membrane protein, HTR2C requires appropriate detergents or lipid environments to maintain its native conformation in solution. The choice of detergent is critical and should be optimized for specific applications.

  • Stabilizing ligands: Including receptor ligands (particularly antagonists) during purification and storage can enhance stability by locking the receptor in specific conformations.

Before conducting critical experiments, it's advisable to validate protein functionality after storage using binding assays or functional tests to ensure the receptor remains active.

How can I optimize transfection conditions for recombinant HTR2C expression in mammalian cells?

Optimizing transfection conditions for recombinant HTR2C expression requires systematic evaluation of multiple parameters to achieve both high expression levels and proper receptor functionality:

  • Cell line selection: HEK293, CHO, or COS-7 cells are commonly used for GPCR expression due to their high transfection efficiency and appropriate post-translational modification machinery. These cell types have been successfully used for related receptors like 5-HT1A .

  • Expression vector optimization: Vectors with strong promoters (CMV, EF1α) and appropriate selection markers enhance expression efficiency. Including a Kozak sequence before the start codon can significantly boost translation efficiency, while codon optimization for the host cell may further improve expression.

  • Transfection method optimization:

    • Lipid-based transfection: Systematically vary lipid:DNA ratio (typically 2:1 to 4:1), DNA concentration (0.5-2 μg/well for 6-well plates), and cell confluence (70-90%)

    • Calcium phosphate: Precise pH adjustment of the calcium chloride solution (pH 7.05-7.15) is critical for efficient transfection

    • Electroporation: Optimize voltage, capacitance, and cell density for each cell type

  • Expression enhancement strategies:

    • Temperature modulation: Lowering incubation temperature to 30-32°C after transfection can improve membrane protein folding

    • Sodium butyrate addition: 5-10 mM sodium butyrate 24 hours post-transfection can enhance expression levels

    • Inducible expression systems: These allow controlled expression timing and level, which can be useful if receptor overexpression affects cell viability

  • Verification methods: Quantify receptor expression through techniques like radioligand binding, flow cytometry with antibody staining, or Western blotting. Importantly, verify that the expressed receptor is functional using signaling assays.

For challenging expression scenarios, co-expression with chaperone proteins or the creation of fusion constructs with well-expressed partners may further enhance expression success.

What are the most reliable assays for measuring HTR2C-mediated signaling pathways?

HTR2C couples to multiple signaling pathways, and several well-established assays can reliably measure these different signaling events:

  • Calcium mobilization assays: As HTR2C primarily couples to Gq/11 proteins leading to intracellular calcium release, calcium flux assays provide a rapid and sensitive measure of receptor activation.

    • Fluorescent calcium indicators (Fluo-4, Fura-2) enable real-time calcium measurements with single-cell resolution

    • High-throughput plate reader platforms allow rapid screening of multiple compounds

    • Aequorin-based bioluminescence assays offer an alternative approach with excellent signal-to-noise characteristics

  • Phosphoinositide signaling assays: These measure the production of inositol phosphates downstream of PLC activation.

    • Traditional approaches use [3H]myo-inositol labeling followed by chromatographic separation

    • Modern non-radioactive alternatives like the IP-One HTRF assay measure accumulation of IP1, providing suitable endpoints for high-throughput screening

  • ERK1/2 phosphorylation assays: These capture both G-protein and β-arrestin-mediated signaling.

    • Western blotting with phospho-specific antibodies provides a traditional readout

    • AlphaScreen SureFire or HTRF-based assays enable quantitative high-throughput measurements

    • Kinetic analysis can distinguish between transient and sustained signaling, which may reflect different activation mechanisms

  • β-arrestin recruitment assays: These measure receptor desensitization and non-G-protein signaling.

    • BRET-based assays between tagged receptors and β-arrestin provide real-time measurements

    • Enzyme complementation assays offer alternative approaches with excellent signal stability

  • Receptor internalization assays: These reflect receptor regulation after activation.

    • Flow cytometry with antibodies against extracellular epitopes quantifies surface receptor populations

    • High-content imaging of fluorescently tagged receptors provides spatial and temporal information

Using multiple complementary assays is highly recommended to obtain a comprehensive signaling profile, as biased ligands may preferentially activate specific pathways over others.

How can I develop a high-throughput screening assay for HTR2C ligands using the recombinant receptor?

Developing a robust high-throughput screening (HTS) assay for HTR2C ligands requires careful assay design, optimization, and validation:

  • Assay format selection: Consider the balance between throughput, physiological relevance, and technical feasibility.

    • Functional assays: Calcium flux assays offer an excellent combination of physiological relevance and HTS compatibility, with rapid kinetics suitable for real-time measurements

    • Binding assays: Fluorescence-based binding assays (fluorescence polarization, TR-FRET) can identify ligands regardless of their functional effects

  • Expression system optimization: Stable cell lines provide better reproducibility than transient transfections for HTS applications.

    • Design inducible expression constructs to control receptor density

    • Confirm receptor homogeneity using radioligand binding assays

    • Verify minimal contribution from endogenous receptors using parental cell controls

  • Assay performance optimization:

    • Determine optimal cell density (typically 10,000-20,000 cells/well for 384-well format)

    • Establish EC80 concentration of reference agonist for antagonist screening mode

    • Calculate Z'-factor under optimized conditions (aim for Z' > 0.5)

    • Determine DMSO tolerance (typically maintain <0.5% final concentration)

  • Validation strategy:

    • Test a panel of known HTR2C ligands with varying potencies to verify assay dynamic range

    • Include structurally diverse compounds to ensure the assay doesn't favor particular chemotypes

    • Conduct replicate runs to assess reproducibility and establish hit criteria thresholds

  • Counter-screening plan:

    • Develop parallel assays using related receptors (HTR2A, HTR2B) to identify selective compounds

    • Include assays for common artifacts (compound autofluorescence, cytotoxicity)

    • Design orthogonal confirmation assays using different detection technologies

Following primary screening, hits should be confirmed through concentration-response studies and orthogonal assays to eliminate false positives and establish accurate potency determinations.

How does the Pan troglodytes HTR2C sequence compare to human HTR2C, and what are the functional implications of these differences?

The Pan troglodytes (chimpanzee) HTR2C shares approximately 99% sequence identity with human HTR2C, reflecting the close evolutionary relationship between these species. This high conservation suggests critical functional importance of the receptor across related primates. A comprehensive sequence analysis reveals:

  • Domain-specific conservation patterns:

    • Transmembrane domains show nearly 100% conservation, indicating strong evolutionary constraints on the receptor core structure

    • Most sequence variations occur in the N-terminal domain and third intracellular loop

    • The ligand binding pocket residues are completely conserved, suggesting identical binding properties for endogenous serotonin

  • Functional domain analysis:

    • G-protein coupling regions: Minor amino acid substitutions in the intracellular loops may subtly affect coupling efficiency to different G-protein subtypes

    • Phosphorylation sites: Differences in serine/threonine residues within intracellular domains could alter receptor desensitization kinetics

    • Glycosylation sites: The N-terminal domain contains conserved N-glycosylation motifs essential for proper trafficking

  • RNA editing considerations:

    • All five RNA editing sites (A, B, C', C, D) are conserved between species

    • The surrounding sequence context of editing sites is identical, suggesting conserved editing mechanisms

    • Species differences may exist in editing efficiency rather than editing site locations

  • Functional implications:

    • Pharmacological profiles: The high conservation suggests most ligands will display similar binding affinities across both species

    • Species differences in signaling: Even minor sequence variations in intracellular domains may produce subtle differences in signaling efficiency or desensitization patterns

    • Regulatory variations: Differences in expression regulation rather than protein sequence may account for any observed functional differences

These comparative insights help determine whether Pan troglodytes HTR2C represents a suitable model for human HTR2C in drug development and basic research contexts.

How can evolutionary analysis of HTR2C across primates inform our understanding of serotonergic system function?

Evolutionary analysis of HTR2C across primates provides valuable insights into serotonergic system function and adaptation:

  • Selective pressure analysis:

    • Comparing non-synonymous to synonymous substitution rates (dN/dS) across primates identifies domains under purifying or positive selection

    • Highly conserved regions likely represent functionally critical domains for serotonergic signaling

    • Rapidly evolving regions may indicate adaptation to species-specific requirements

  • Comparative genomics approaches:

    • Analysis of promoter regions can reveal conservation of transcriptional regulatory elements

    • Examination of RNA editing site conservation provides insights into the evolutionary importance of this post-transcriptional regulation mechanism

    • Identification of conserved intronic elements may uncover important regulatory features

  • Structure-function correlations:

    • Mapping conserved and variable regions onto 3D receptor models illuminates functional constraints

    • Comparing ligand binding pocket architecture across species helps predict pharmacological differences

    • Analyzing species variations in G-protein coupling domains can reveal flexibility in signaling mechanisms

  • Behavioral and physiological correlations:

    • Correlating receptor variations with species differences in cognitive function, social behavior, or stress responses

    • Examining HTR2C evolution in the context of dietary adaptations that might influence serotonergic tone

    • Investigating correlations between HTR2C variations and species differences in vulnerability to psychiatric-like phenotypes

  • Disease relevance:

    • Identifying naturally occurring receptor variants that mimic human disease-associated polymorphisms

    • Studying species differences in receptor regulation that might protect against conditions like depression or anxiety

    • Understanding conservation of drug binding sites to improve translational relevance of animal models

This evolutionary perspective provides a broader context for understanding fundamental aspects of serotonergic signaling that have been conserved through primate evolution versus aspects that show species-specific adaptation.

What are common challenges in expressing functional recombinant HTR2C, and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional recombinant HTR2C, many of which are common to membrane proteins and GPCRs:

  • Low expression levels:

    • Cause: Inefficient transcription, translation, or protein folding

    • Solution: Optimize codon usage for the expression host; employ stronger promoters; create fusion constructs with well-expressed partners (e.g., maltose-binding protein)

    • Alternative approach: Test different expression systems, as some cell types may provide better folding environments for this specific receptor

  • Protein misfolding and aggregation:

    • Cause: Complex membrane protein folding requirements, hydrophobic transmembrane domains

    • Solution: Lower incubation temperature (30-32°C) after induction; add chemical chaperones like 4-phenylbutyrate; optimize detergent selection for membrane preparation

    • Alternative approach: Include stabilizing mutations based on structural analysis of related receptors; co-express with molecular chaperones

  • Poor membrane trafficking:

    • Cause: Inefficient export from ER, quality control mechanisms retaining misfolded protein

    • Solution: Add trafficking enhancers; create fusion with known trafficking signals; verify glycosylation status

    • Alternative approach: Generate chimeric receptors with well-trafficked GPCRs, maintaining the key functional domains of HTR2C

  • Ligand binding issues:

    • Cause: Improper folding of binding pocket, missing post-translational modifications

    • Solution: Verify binding pocket integrity through mutagenesis of key residues; ensure proper post-translational modifications

    • Alternative approach: Express with known ligands present to stabilize native conformation during expression and purification

  • Limited functional coupling:

    • Cause: Insufficient G-protein expression, improper receptor conformation

    • Solution: Co-express with appropriate G-proteins; ensure cells express necessary downstream signaling components

    • Alternative approach: Use chimeric G-proteins with enhanced coupling efficiency; supplement with receptor-interacting proteins

  • High constitutive activity:

    • Cause: Spontaneous adoption of active conformation in absence of ligand

    • Solution: Use inverse agonists during expression to stabilize inactive conformation

    • Alternative approach: Introduce mutations that reduce constitutive activity without affecting ligand response

These issues can be systematically addressed through careful optimization of expression conditions and application of multiple strategies to overcome specific obstacles encountered with HTR2C expression.

Why might I observe different pharmacological profiles for the same recombinant HTR2C across different assay systems?

Different pharmacological profiles for recombinant HTR2C across assay systems is a common observation that can result from several important factors:

  • Pathway-biased signaling:

    • Different assays measure distinct signaling pathways (G-protein vs. β-arrestin)

    • Ligands may selectively activate certain pathways over others (biased agonism)

    • Solution: Characterize compounds using multiple pathway assays to develop complete signaling fingerprints

  • Receptor reserve effects:

    • High receptor expression creates a "spare receptor" phenomenon where maximal response occurs with only partial receptor occupancy

    • This shifts apparent potency in high-expression systems compared to low-expression systems

    • Solution: Determine receptor expression levels across systems and apply operational models to normalize for receptor reserve

  • Cell-specific signaling machinery:

    • Different cell types express varying levels and subtypes of G-proteins, arrestins, and other signaling components

    • Post-translational modifications of the receptor may differ between cell types

    • Solution: Characterize signaling component expression in different cell systems; consider reconstitution experiments with defined signaling machinery

  • Temporal response differences:

    • Rapid assays (calcium flux) measure immediate responses while others (gene reporter) capture delayed events

    • Receptor desensitization affects longer time-course measurements but may not impact rapid assays

    • Solution: Conduct time-course studies to understand response kinetics; consider how receptor regulation impacts different assay endpoints

  • Assay condition variations:

    • Buffer composition, pH, ionic strength, and temperature influence receptor conformation and ligand binding

    • Presence of sodium ions can stabilize inactive GPCR conformations, shifting antagonist potency

    • Solution: Standardize conditions across platforms; document environmental parameters that may affect results

Understanding these factors allows researchers to select appropriate assay systems for specific research questions and to correctly interpret data across different experimental platforms. This is particularly important when translating findings from screening assays to more complex physiological systems.

How should I analyze and interpret RNA editing data for HTR2C across different experimental conditions?

RNA editing of HTR2C creates receptor isoforms with altered signaling properties, requiring specialized analysis approaches:

  • Quantitative editing assessment methods:

    • Direct sequencing: Measures editing at individual sites by analyzing chromatogram peak height ratios

    • Next-generation sequencing: Provides comprehensive isoform distribution analysis with higher sensitivity for minor variants

    • Restriction fragment length polymorphism: Can quantify editing at specific sites that create or eliminate restriction sites

    • Poisoned primer extension: Offers quantitative site-specific editing analysis with good sensitivity

  • Statistical analysis considerations:

    • Editing at multiple sites requires correction for multiple comparisons (e.g., Bonferroni or false discovery rate adjustment)

    • Non-independent editing at different sites may require multivariate analysis approaches

    • Bootstrap methods can improve confidence interval estimation for complex editing patterns

    • Mixed-effects models account for within-subject correlation when analyzing repeated measures

  • Functional correlation analysis:

    • Calculate predicted protein isoform distributions based on editing frequencies

    • Correlate editing profiles with functional measurements in parallel assays

    • Consider the relative physiological impact of each resultant protein isoform based on known G-protein coupling efficiency

  • Visualization approaches:

    • Stacked bar charts effectively display the distribution of different RNA edited isoforms

    • Heatmaps can visualize editing patterns across conditions and sites

    • Network diagrams can represent the relationships between different editing sites when co-regulation occurs

  • Interpretation frameworks:

    • Compare observed editing changes to established patterns in relevant physiological or disease states

    • Consider how editing changes might affect the G-protein coupling efficiency based on the amino acids being substituted

    • Evaluate whether editing changes are consistent with adaptive responses to experimental manipulations

By systematically analyzing editing data, researchers can gain insights into how HTR2C regulation contributes to receptor function and adaptation under different experimental conditions, providing a deeper understanding of the functional significance of this unique regulatory mechanism.

What statistical approaches are most appropriate for analyzing HTR2C ligand screening data?

Robust statistical analysis of HTR2C ligand screening data is essential for identifying true hits while minimizing false positives:

  • Primary screening data analysis:

    • Calculate Z'-factor to assess assay quality (Z' > 0.5 indicates an excellent assay)

    • Apply plate normalization methods to correct for positional effects and edge artifacts

    • Use robust statistics (median and MAD) instead of mean and standard deviation to reduce outlier influence

    • Set hit thresholds based on statistical significance (typically 3 SD or 3 MAD from controls) rather than arbitrary cutoffs

  • Concentration-response analysis:

    • Fit data to appropriate models (four-parameter logistic for full curves) using nonlinear regression

    • Calculate EC50/IC50 values with 95% confidence intervals to properly represent estimation uncertainty

    • Compare curves using extra sum-of-squares F test to determine statistical significance of potency differences

    • Apply constraints based on mechanistic understanding (e.g., shared Hill slopes for compounds in the same class)

  • Selectivity quantification:

    • Calculate selectivity indices (ratio of potencies) between HTR2C and related receptors (HTR2A, HTR2B)

    • Develop selectivity visualization tools like radar plots or selectivity matrices

    • Apply principal component analysis to identify compounds with unique selectivity profiles

    • Construct correlation matrices to identify relationships between activity at different receptor subtypes

  • Structure-activity relationship analysis:

    • Use regression models to correlate structural features with activity

    • Apply machine learning approaches (random forests, support vector machines) for complex datasets

    • Implement cross-validation to prevent overfitting and assess predictive power

    • Identify activity cliffs where small structural changes produce large activity differences

  • Assay artifact recognition:

    • Plot compound potency correlation across orthogonal assays to identify consistent vs. assay-specific activity

    • Analyze patterns of compounds flagged across multiple screens to identify promiscuous inhibitors

    • Implement counterscreens to identify and eliminate compounds acting through non-specific mechanisms

These statistical approaches should be implemented within a systematic workflow that moves efficiently from primary screening through hit confirmation and characterization, ensuring that resources are focused on the most promising and reliable hits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.