Recombinant Pan troglodytes 5-hydroxytryptamine receptor 6 (HTR6)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Expression

Recombinant HTR6 is synthesized using multiple expression systems to ensure functional versatility:

Product CodeExpression SystemTagApplication
CSB-CF683300EQVE. coli (in vitro)Variable (determined post-production)ELISA, WB, ligand binding
CSB-YP683300EQV1YeastPartial protein expressionStructural studies
CSB-EP683300EQV1-BMammalian cells (Biotinylated)Biotin tagPull-down assays

Data sourced from .

Key production notes:

  • Storage: Tris-based buffer with 50% glycerol at -20°C or -80°C .

  • Purity: Validated via SDS-PAGE and mass spectrometry .

Neuronal Development and Signaling

  • Neuronal Migration: Regulates corticogenesis via cyclin-dependent kinase 5 (Cdk5) interactions .

  • cAMP Pathways: Agonist-independent activation increases cAMP production through GPRIN1 coupling, enhancing neurite extension in striatal neurons .

  • mTORC1 Signaling: Modulates synaptic plasticity and memory formation; knockdown mimics dietary restriction-induced cognitive enhancement .

Disease Relevance

  • Epilepsy: Antagonism reduces hippocampal pyramidal neuron excitability by downregulating KCNQ2/3 channels .

  • Cognitive Disorders: HTR6 antagonists (e.g., SB-742,457) improve memory in rodent models but show limited clinical efficacy in Alzheimer’s trials .

Key Experimental Findings

  • Ciliary Trafficking: Dual ciliary targeting sequences (IC3 and CT) enable redundancy in TULP3/RABL2-dependent localization .

  • Behavioral Studies:

    • Novel Object Recognition (NOR) Tests: Antagonists reverse memory deficits at 1–3 mg/kg doses in rats .

    • Dietary Restriction Models: HTR6 knockout mice exhibit enhanced memory indexes, mimicking DR effects .

Pharmacological Profiling

  • Agonists: WAY-208,466 (EC₅₀ = 0.9 nM) enhances GABAergic signaling .

  • Antagonists: SAM-315 (K₁ = 1.3 nM) shows procognitive effects but poor brain penetration .

Recent Advances and Future Directions

  • Structural Biology: Cryo-EM studies aim to resolve HTR6’s active-state conformation for drug design .

  • Gene Therapy: Viral vector delivery of HTR6 rescues synaptic deficits in knockout models .

  • Clinical Trials: Dual 5-HT6/5-HT2A antagonists (e.g., EGIS-12233) are under evaluation for schizophrenia .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR6; 5-hydroxytryptamine receptor 6; 5-HT-6; 5-HT6; Serotonin receptor 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MVPEPGPSANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTPPRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATRDPPLPTRAAAAVNF FNIDPAEPELRPHPLGIPTN
Uniprot No.

Target Background

Function
This receptor is one of several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Its activity is mediated by G proteins that stimulate adenylate cyclase. This receptor exhibits high affinity for tricyclic psychotropic drugs. It controls pyramidal neurons migration during corticogenesis by regulating CDK5 activity. Additionally, it serves as an activator of TOR signaling.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HTR6 and what are its key functional characteristics in primates?

5-hydroxytryptamine receptor 6 (HTR6) is a G protein-coupled receptor for serotonin that functions as a neurotransmitter, hormone, and mitogen . This receptor has high affinity for tricyclic psychotropic drugs and is coupled to G(s) G alpha proteins, mediating activation of adenylate cyclase activity .

In primates, HTR6 plays crucial roles in:

  • Controlling pyramidal neuron migration during corticogenesis through CDK5 regulation

  • Activating mTOR signaling pathways

  • Modulating cognitive processes including memory and learning

Methodologically, researchers can confirm HTR6 functionality through cAMP assays, as the receptor activates cAMP production upon serotonin stimulation. For instance, in NG108-15 cells, wild-type HTR6 exhibits constitutive activity of approximately 669 ± 1.5 pmol cAMP per 1 mg protein with an EC50 of 0.764 ± 0.065 nM for serotonin .

What expression systems are most effective for producing recombinant Pan troglodytes HTR6?

Multiple expression systems have been validated for producing Recombinant Pan troglodytes HTR6:

CodeExpression SystemNotes
CSB-CF683300EQVE. coli expression systemFor in vitro applications
CSB-YP683300EQV1Yeast expression systemFor partial HTR6 expression
CSB-EP683300EQV1E. coli expression systemFor partial HTR6 expression
CSB-BP683300EQV1Baculovirus expression systemFor partial HTR6 expression
CSB-MP683300EQV1Mammalian cell expression systemFor partial HTR6 expression
CSB-EP683300EQV1-BIn Vivo Biotinylation in E. coliFor partial HTR6 expression

When selecting an expression system, researchers should consider:

  • E. coli systems provide high yields but may lack post-translational modifications

  • Mammalian expression systems offer proper folding and post-translational modifications essential for functional studies

  • Baculovirus systems balance yield with more accurate post-translational modifications

For detailed functional studies, mammalian expression in HEK293 cells has been validated for producing functional HTR6 protein that maintains signaling capabilities .

How is HTR6 distributed in the central nervous system of primates?

HTR6 shows a specific distribution pattern in primate brains:

  • In cynomolgus monkeys, PET imaging with [18F]2FNQ1P radioligand has revealed both cortical and subcortical HTR6 distribution

  • Highest receptor densities are observed in the striatum and sensorimotor cortex

  • The cerebellum shows minimal HTR6 expression, making it suitable as a reference region in binding studies

For visualization and quantification:

  • Autoradiography using selective ligands provides high-resolution mapping

  • PET imaging offers in vivo assessment with the Logan graphical model showing the best tracer binding indices with highest magnitude and lowest standard deviation

  • Pre-injection of HTR6 antagonists (e.g., SB258585) significantly decreases binding in HTR6-rich regions, confirming specificity

The distribution pattern aligns with HTR6's involvement in cognitive functions, making it a relevant target for studying neurological disorders in primates.

How do the intracellular domains of HTR6 regulate its trafficking and signaling properties?

HTR6 contains multiple critical intracellular domains that regulate its trafficking and signaling:

IC3 Loops and C-Terminal Domains:
HTR6 ciliary targeting relies on redundant ciliary targeting sequences (CTSs) in both the third intracellular loop (IC3) and C-terminal tail (CT). These domains function with ciliary trafficking adapters:

  • For HTR6, an RKQ motif is key for IC3 CTS (CTS1) function

  • An LPG motif is critical for C-terminal CTS (CTS2) function

  • Removal of both IC3 and CT completely prevents ciliary accumulation

Trafficking Mechanisms:

  • HTR6 ciliary targeting is TULP3-dependent

  • HTR6's C-terminal associates with TULP3, mediated by sequences near the LPG motif

  • The LPG motif itself antagonizes TULP3 association, suggesting TULP3 dissociation is an important step for HTR6 ciliary accumulation

Research methodologies should include:

  • Generation of deletion mutants to identify critical residues

  • Co-immunoprecipitation to assess protein-protein interactions

  • Immunofluorescence microscopy to visualize trafficking

  • Functional assays (cAMP accumulation) to link trafficking to signaling outcomes

What is the structural basis for HTR6 constitutive activity and how does it differ from other serotonin receptors?

HTR6 exhibits unusually high constitutive activity compared to other serotonin receptors, with specific structural features responsible:

Toggle Switch Mechanism:

  • HTR6 contains a T6.47 residue in its toggle switch motif instead of the C6.47 found in most Class A GPCRs (CWxP motif)

  • Replacing T6.47 with C6.47 significantly reduces basal activity

  • An interhelical hydrogen bond between T6.47 and N7.45 appears to partially confer high basal activity

G-Protein Interface:

  • Cryo-EM structure of serotonin-activated HTR6 shows distinct positioning of TM7 cytoplasmic ends

  • R325 (position 8.48) shifts closer to R389 (G.H5.21) of the Gαs protein

  • This creates a repulsive force surrounded by charge-incompatible HTR6 and Gαs surface areas, enhancing constitutive activity

Conformational Changes:
When comparing with inactive β2AR and active HTR6 states:

  • Outward rotation of TM6 by 7.9 Å (measured between Cα atoms)

  • Inward movement of TM7 by 5.0 Å

  • These movements allow C-terminal helix of G protein α subunit to engage receptor core

Research approaches should include:

  • Site-directed mutagenesis targeting key residues

  • Molecular dynamics simulations

  • Structural studies (cryo-EM or crystallography)

  • G-protein coupling assays to measure constitutive activity

How does HTR6 interact with mTORC1 signaling to regulate memory processes?

HTR6 uniquely regulates memory formation through mTORC1 signaling:

Dietary Restriction (DR) Model:

  • DR induces downregulation of HTR6 in hippocampus and prefrontal cortex

  • This downregulation correlates with reduced serotonergic activity (lower 5-HIAA/5-HT ratio)

  • HTR6 knockout mice exhibit enhanced memory performance and long-term potentiation (LTP) similar to DR mice

  • DR does not further enhance LTP in HTR6 knockout mice, suggesting HTR6 is downstream of DR effects

Signaling Mechanism:

  • HTR6 activates cAMP production as a Gs-coupled receptor

  • DR reduces PKA phosphorylation but increases CREB-1 phosphorylation

  • HTR6 regulates mTORC1 signaling, which functions as a nutrient sensor in hippocampal neurons

Experimental Approaches:

  • Electrophysiological recordings to measure LTP in hippocampal slices

  • Behavioral tests (e.g., novel object recognition, Morris water maze) to assess memory

  • Western blotting for downstream signaling components (PKA, CREB-1, mTOR)

  • Rescue experiments using viral-mediated gene transfer

  • Pharmacological manipulation with selective HTR6 antagonists

The data suggests HTR6 antagonism as a potential therapeutic strategy for cognitive enhancement.

What is the significance of HTR6 heterodimerization with other receptors in primate brains?

HTR6 forms functional heterodimers with other receptors, most notably with 5-HT4R:

Evidence for HTR6/5-HT4R Heterodimers:

  • Co-expression analysis shows 5-HT4R and HTR6 are expressed in the same brain regions

  • Gene expression is co-regulated in both normal and Alzheimer's disease subjects

  • Protein co-evolution analysis indicates functional interaction between these receptors

  • Direct Coupling Analysis followed by local convolution of Evolutionary Scores confirms interaction with p-value = 0.02

Functional Implications:

  • Previous pharmacological approaches targeted single receptors (agonists for 5-HT4R or antagonists for HTR6)

  • Heterodimer targeting could provide improved therapeutic outcomes

  • The dimer interface represents a novel target for drug development

Methodological Approaches:

  • Resonance energy transfer techniques (BRET/FRET) to confirm physical interaction

  • Co-immunoprecipitation studies from brain tissue

  • Bioinformatic analysis of co-evolution patterns

  • Single-cell RNA sequencing to identify co-expressing neurons

  • Functional assays comparing signaling of monomers versus heterodimers

This research direction has significant implications for developing more effective therapeutic strategies for neurological disorders.

What methodological considerations are critical when using PET imaging to study HTR6 in primates?

PET imaging of HTR6 in primates requires specific methodological considerations:

Radioligand Selection:

  • [18F]2FNQ1P is the first fluorinated PET radioligand validated for HTR6

  • In vitro autoradiography shows wide cerebral distribution with specificity toward HTR6

  • Binding is effectively displaced by selective antagonist SB258585

Data Analysis Models:
Comparative analysis shows the Logan graphical model provides:

  • Highest magnitude of binding indices

  • Lowest standard deviation

  • Best reproducibility and robustness compared to simplified reference tissue model

Reference Region Selection:

  • Cerebellum serves as the optimal reference region due to minimal HTR6 expression

  • This enables calculation of binding indices without arterial blood sampling

Image Processing:

  • Automated spatial normalization methods produce superior results compared to manual approaches

  • Reproducible distribution at both cortical and subcortical levels can be achieved

Validation Protocol:

  • Test-retest studies to assess binding reproducibility (validated in five animals)

  • Specificity testing using pre-injection of 5-HT6R antagonist (SB258585)

  • Comparison of different quantification models

  • Cross-validation with in vitro autoradiography

These methodological considerations ensure reliable and reproducible HTR6 quantification in primate brains.

How can researchers validate the specificity and functionality of recombinant Pan troglodytes HTR6?

A comprehensive validation protocol for recombinant Pan troglodytes HTR6 should include:

Binding Assays:

  • Saturation binding with selective HTR6 ligands to determine Kd and Bmax values

  • Competition binding with known HTR6 agonists and antagonists

  • Comparison with human HTR6 to identify species-specific differences

Functional Assays:

  • cAMP accumulation assays to confirm Gs-coupling (baseline should show constitutive activity)

  • CREB phosphorylation as a downstream readout

  • mTOR activation assays to verify signaling pathway engagement

Molecular Characterization:

  • Western blotting with selective antibodies

  • Surface expression analysis by immunofluorescence or flow cytometry

  • Mass spectrometry to confirm protein integrity and post-translational modifications

Pharmacological Validation:
Compare responses to reference compounds:

  • Agonists should induce cAMP production with expected potencies

  • Antagonists should block agonist effects

  • Inverse agonists should reduce constitutive activity

For example, wild-type HTR6 exhibits an EC50 of approximately 0.764 ± 0.065 nM for serotonin in functional assays, which can serve as a reference point .

What are the critical differences between human and Pan troglodytes HTR6 that affect experimental design?

While human and Pan troglodytes HTR6 share high sequence homology, several differences are critical for experimental design:

Sequence and Structural Variations:

  • Focus on regions involved in ligand binding, G-protein coupling, and constitutive activity

  • Particularly examine the toggle switch region (position 6.47) and TM7 cytoplasmic ends

  • Analyze potential differences in phosphorylation sites that may affect receptor regulation

Pharmacological Differences:

  • Comparative binding studies with selective ligands may reveal species-specific affinities

  • Constitutive activity levels may differ between species

  • Response to inverse agonists should be carefully compared

Expression System Considerations:

  • Expression levels may vary between species when using identical systems

  • Codon optimization might be necessary for optimal expression

  • Post-translational modification patterns may differ

Methodological Approaches:

  • Sequence alignment and homology modeling

  • Site-directed mutagenesis to identify functionally important residues

  • Comparative pharmacology in identical expression systems

  • Cross-species chimeras to identify domains responsible for functional differences

Understanding these differences is crucial for translating findings between species and for developing selective compounds for research.

How can HTR6 ciliary targeting mechanisms be exploited in experimental designs?

HTR6 ciliary targeting offers unique experimental opportunities:

Key Ciliary Targeting Sequences:

  • HTR6 contains two ciliary targeting sequences (CTSs):

    • CTS1 in the IC3 loop (dependent on RKQ motif)

    • CTS2 in the C-terminal (dependent on LPG motif)

  • Both sequences work cooperatively but can function independently

Experimental Applications:

  • Visualizing Neuronal Cilia:

    • HTR6-GFP fusion proteins serve as excellent ciliary markers

    • Knock-in mice expressing 5-HT6-GFP receptor show membrane expression and functionality similar to wild-type

  • Studying Ciliary Transport:

    • HTR6 association with TULP3 and RABL2B provides a model for studying ciliary protein trafficking

    • TULP3 dissociation appears to be a critical step for HTR6 ciliary accumulation

  • Neurodevelopmental Studies:

    • HTR6 controls pyramidal neuron migration via ciliary localization

    • Manipulating ciliary targeting sequences can help investigate neurodevelopmental processes

Methodological Approaches:

  • Generate chimeric receptors to identify minimal ciliary targeting sequences

  • Use fluorescently tagged HTR6 to track ciliary targeting in real-time

  • Create point mutations in key motifs (RKQ, LPG) to disrupt targeting

  • Apply CRISPR-Cas9 to modify endogenous HTR6 ciliary targeting

This approach allows researchers to study both HTR6 biology and broader ciliary trafficking mechanisms.

What are the most promising applications of recombinant HTR6 in neurodegenerative disease research?

HTR6 has emerged as a significant target in neurodegenerative disease research:

Alzheimer's Disease Applications:

  • HTR6 antagonists consistently enhance mnemonic performance across various procedures in rodents

  • Preliminary evidence supports procognitive properties of HTR6 antagonists in humans

  • HTR6 and 5-HT4R dimerization appears relevant to Alzheimer's pathology

  • HTR6-mediated mTORC1 signaling affects cognitive functions compromised in Alzheimer's

Experimental Approaches:

  • Drug Discovery Platforms:

    • Recombinant HTR6 enables high-throughput screening for novel antagonists

    • Structure-based drug design using HTR6 cryo-EM structures

    • Fragment-based approaches targeting specific functional domains

  • Disease Modeling:

    • HTR6 expression in patient-derived neurons to study receptor dynamics

    • Integration with amyloid-beta or tau pathology models

    • Examination of HTR6/5-HT4R heterodimerization in disease contexts

  • Therapeutic Strategies:

    • Target the HTR6-neurofibromin interaction, which modulates constitutive activity

    • Develop biased ligands targeting specific HTR6 signaling pathways

    • Design dual-targeting compounds for HTR6/5-HT4R heterodimers

HTR6 research may contribute to identifying new cognitive-enhancing therapies that address the fundamental mechanisms of neurodegenerative diseases rather than just symptomatic treatment.

How can evolutionary analysis of HTR6 across primate species inform therapeutic development?

Evolutionary analysis of HTR6 across primates provides valuable insights for therapeutic development:

Phylogenetic Approach:

  • 5-HT3 receptor phylogenetic analysis across Metazoa revealed conservation patterns that can be extended to HTR6

  • Identifying highly conserved residues in ligand binding regions across primates indicates functionally critical domains

  • Analyzing variations in less conserved regions helps understand species-specific responses to drugs

Key Research Strategies:

  • Comparative Sequence Analysis:

    • Multiple sequence alignment of HTR6 across primate species

    • Identification of conserved motifs in ligand binding and G-protein coupling domains

    • Analysis of selection pressure on different receptor domains

  • Structure-Function Relationships:

    • Map conserved regions onto HTR6 structural models

    • Identify co-evolving residues that maintain functional interactions

    • Determine if primate-specific HTR6 features relate to cognitive capabilities

  • Drug Design Applications:

    • Target highly conserved regions for broad-spectrum activity

    • Exploit primate-specific features for increased selectivity

    • Use evolutionary data to predict off-target effects

This approach can identify "evolutionary hotspots" that might be more tolerant to therapeutic targeting while minimizing disruption of essential functions, potentially leading to safer and more effective drugs.

What methodological approaches are most effective for studying HTR6 in neural development?

Studying HTR6 in neural development requires specialized methodologies:

Developmental Expression Analysis:

  • Temporal and spatial mapping of HTR6 expression during cortical development

  • Single-cell RNA sequencing to identify HTR6-expressing neural progenitors and neurons

  • Correlation with neurogenesis, migration, and differentiation markers

Functional Assessment Techniques:

  • In Utero Electroporation:

    • Introduce HTR6 constructs (wild-type, mutants, or shRNA) into developing cortex

    • Label cells with fluorescent markers to track migration and morphology

    • Analyze pyramidal neuron positioning and dendritic development

  • Organoid Models:

    • Generate brain organoids from stem cells with modified HTR6 expression

    • Monitor neuronal migration and organization in 3D context

    • Assess the impact of HTR6 signaling on cortical layer formation

  • CDK5 Pathway Analysis:

    • HTR6 controls pyramidal neuron migration through CDK5 regulation

    • Measure CDK5 activity in HTR6-manipulated developing neurons

    • Conduct rescue experiments with CDK5 activators/inhibitors

  • Ciliary Function Assessment:

    • Monitor primary cilia dynamics during neuronal migration

    • Investigate how HTR6 ciliary targeting affects neuronal positioning

    • Examine interaction with other ciliary proteins during development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.