Recombinant Pan troglodytes ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
MNENLFASFAAPTILGLPAAVLIILFPPLLVPTSKHLINNRLITTQQWLIQLTSKQMMTM HSTKGRTWSLMLVSLIIFITTTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGAVVMGFRFK TKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA LSTINLPYALIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) synthesizes ATP from ADP in the presence of a proton gradient across the membrane, which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in mitochondrial function?

MT-ATP6 is mitochondrially encoded ATP synthase 6, a critical subunit of the F0 complex of transmembrane F-type ATP synthase. It functions as part of the membrane-embedded portion of ATP synthase (Complex V) where it plays an essential role in moving protons across the mitochondrial inner membrane coupled to ATP synthesis. The protein is crucial for the process of oxidative phosphorylation, whereby ATP is formed from ADP and inorganic phosphate by utilizing the electrochemical gradient of protons across the inner membrane . ATP synthase not only synthesizes ATP but is also critical for maintaining the architecture of the mitochondrial inner membrane . In Pan troglodytes, this protein shares high sequence homology with human MT-ATP6, reflecting the conserved nature of this essential mitochondrial component.

How conserved is MT-ATP6 between Pan troglodytes and humans?

MT-ATP6 is highly conserved between Pan troglodytes and humans, with sequence identity exceeding 98%. This high degree of conservation reflects the protein's essential role in energy metabolism. Research has demonstrated that mitochondrially encoded proteins like MT-ATP6 show strong evolutionary conservation, particularly in regions critical for function, such as proton channels and binding interfaces . The conserved nature makes Pan troglodytes MT-ATP6 a valuable model for studying human mitochondrial disorders associated with MT-ATP6 mutations. Comparative analyses of specific residues (e.g., those at positions corresponding to human p.I106, p.V142, p.I164) show identical amino acids in these functionally significant regions, further supporting the utility of chimpanzee models in human mitochondrial disease research .

What pathways involve MT-ATP6 and how are they studied?

MT-ATP6 participates in several critical cellular pathways, primarily:

Pathway NameAssociated ProteinsResearch Relevance
Oxidative phosphorylationNDUFB10, ATP5J, NDUFV1, NDUFA5, COX4I2, NDUFS3Primary energy production pathway
Metabolic pathwaysNT5C1AA, SUCLA2, PDHA1, ASS1, PDHB, COQ5Broader metabolic context
Parkinsons diseaseMT-ND4, PRKACB, NDUFS6, NDUFS3, UQCRC2, SDHBNeurodegenerative connection
Alzheimers diseaseNDUFV2, LPL, CDK5R1, ATP5E, PSEN1, APH1BNeurodegenerative connection
Huntingtons diseaseDNAH6, VDAC2, SLC25A5, HDAC1, NDUFA5Neurodegenerative connection

These pathways are typically studied using techniques including BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis) for complex assembly analysis, oxygen consumption measurements for respiratory function, ATP synthesis assays, and mitochondrial membrane potential assessments . The integration of MT-ATP6 into these pathways makes it a significant target for understanding both normal cellular energetics and disease mechanisms.

What approaches are most effective for expressing and purifying recombinant Pan troglodytes MT-ATP6?

Expression and purification of recombinant MT-ATP6 present considerable challenges due to its highly hydrophobic nature and mitochondrial membrane integration. The most effective approaches include:

  • Heterologous expression systems: Yeast expression systems (particularly Saccharomyces cerevisiae) have proven effective for producing functional ATP synthase components, as yeast can properly process and assemble mitochondrial proteins . For Pan troglodytes MT-ATP6, codon optimization for the expression host is critical.

  • Purification strategy: A multi-step purification process typically includes:

    • Membrane isolation and solubilization using mild detergents (digitonin or n-dodecyl β-D-maltoside)

    • Affinity chromatography using strategically placed tags (typically 6xHis tags)

    • Size exclusion chromatography for final purification

  • Quality control metrics: Purity assessment by SDS-PAGE (typically >90% is achievable), functional validation through ATP synthesis assays, and structural integrity confirmation via limited proteolysis .

The expression system must maintain the protein's native conformation while providing sufficient yields. When expressed in yeast, recombinant MT-ATP6 proteins can reach acceptable purity levels (>90% as determined by SDS-PAGE) with observed molecular weights corresponding to theoretical predictions .

How can researchers effectively study MT-ATP6 mutations and their impact on ATP synthase function?

The study of MT-ATP6 mutations requires a systematic approach:

Recent research demonstrated that mutations corresponding to human m.8950G>A, m.9025G>A, and m.9029A>G significantly compromise ATP synthase function while others (m.8843T>C, m.9016A>G, m.9058A>G, m.9139G>A, m.9160T>C) have minimal effects .

What techniques provide the most accurate structural information about recombinant MT-ATP6?

Multiple complementary approaches yield comprehensive structural insights:

  • Cryo-electron microscopy (Cryo-EM): Currently the gold standard for ATP synthase structural studies, providing resolutions that can reach 3-4Å for the membrane domain, allowing visualization of subunit interactions and proton pathways . This technique has successfully revealed the rotational states of bacterial ATP synthases and can be applied to Pan troglodytes ATP synthase.

  • Cross-linking mass spectrometry (XL-MS): Identifies interacting regions between MT-ATP6 and other subunits, providing valuable constraints for structural modeling.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps solvent-accessible regions and conformational dynamics.

  • Computational approaches: Molecular dynamics simulations can model proton movement through MT-ATP6's critical half-channels and predict effects of mutations on protein stability and function.

The integration of data from these techniques provides the most complete structural understanding. Recent cryo-EM studies of bacterial ATP synthases have demonstrated how the membrane region architecture enables ATP synthase to perform core functions while maintaining simplicity compared to more complex mitochondrial systems .

What are the molecular mechanisms of proton translocation through Pan troglodytes MT-ATP6, and how do they compare to bacterial and human counterparts?

Proton translocation through MT-ATP6 involves a sophisticated mechanism:

  • Structural basis: MT-ATP6 contains two half-channels that do not form a continuous proton pathway. The proton enters through one half-channel, interacts with a conserved arginine residue, and exits through the second half-channel after rotation of the c-ring .

  • Key residues: Several highly conserved residues form the proton pathway:

    • Arginine at the interface between half-channels

    • Glutamate residues in the c-ring that accept/donate protons

    • Polar residues lining the half-channels that facilitate proton movement

  • Comparative mechanics: Pan troglodytes MT-ATP6 shares the same core translocation mechanism as human MT-ATP6, with identical key residues. Bacterial systems (e.g., Bacillus PS3) utilize similar principles but with a simpler subunit composition .

  • Energetic coupling: Proton movement through MT-ATP6 induces rotation of the c-ring, which is transmitted to the central stalk, driving conformational changes in the catalytic sites that synthesize ATP.

How do heteroplasmic MT-ATP6 mutations behave differently between cell models and organism models, and what are the implications for disease studies?

Heteroplasmy (the coexistence of wild-type and mutant mtDNA) presents complex research challenges:

  • Model system differences:

    • Cell models: Human cell lines can maintain stable heteroplasmy levels, allowing threshold effect studies, but may not recapitulate tissue-specific effects.

    • Yeast models: Cannot stably maintain heteroplasmy, making them useful for studying homoplasmic effects but limiting for heteroplasmy dynamics research .

    • Animal models: Can exhibit tissue-specific segregation of heteroplasmic mutations, more closely mimicking human disease.

  • Threshold effects: MT-ATP6 mutations typically show biochemical defects when mutation loads exceed 70-90%, with tissue-specific thresholds depending on energy demands.

  • Methodological considerations:

    • Pyrosequencing or next-generation sequencing for accurate heteroplasmy quantification

    • Single-cell analysis to detect potential genetic drift

    • Tissue-specific functional assessments correlating mutation loads with bioenergetic capacity

  • Research implications: Understanding heteroplasmy dynamics is crucial for predicting disease progression and developing interventions. Mutations like m.8950G>A, m.9025G>A, and m.9029A>G that significantly impact ATP synthase function even at lower heteroplasmy levels represent higher pathogenic potential .

The challenge in heteroplasmy research lies in correlating mutation loads with functional deficits across different tissues and understanding the compensatory mechanisms that establish the threshold effect.

What advanced approaches can detect subtle conformational changes in MT-ATP6 during catalytic cycles and under pathological conditions?

Detecting subtle conformational changes requires sophisticated technologies:

  • Time-resolved cryo-EM: Captures transitional states during the catalytic cycle, revealing short-lived conformational changes in the proton pathway.

  • Site-directed spin labeling with electron paramagnetic resonance (SDSL-EPR): Measures distances between specific sites during conformational changes with angstrom resolution.

  • Single-molecule FRET (smFRET): Tracks real-time conformational dynamics in reconstituted systems.

  • Advanced computational approaches:

    • Coarse-grained molecular dynamics to model longer timescale conformational changes

    • Enhanced sampling techniques to identify rare conformational states

    • Markov state modeling to understand conformational transition networks

  • Native mass spectrometry: Detects changes in subunit interactions under different conditions.

These approaches reveal how MT-ATP6 conformational dynamics are altered by mutations or environmental conditions. For example, structural studies of bacterial ATP synthases have demonstrated how subunit ε positioning inhibits ATP hydrolysis while permitting synthesis, a mechanism likely conserved in Pan troglodytes MT-ATP6 . Understanding these subtle conformational changes is crucial for developing targeted therapeutic interventions for mitochondrial diseases.

What are the optimal conditions for functional assays of recombinant Pan troglodytes MT-ATP6?

Optimal functional assay conditions must balance physiological relevance with technical feasibility:

  • ATP synthesis assays:

    • Buffer composition: 10 mM HEPES-KOH (pH 7.5), 100 mM KCl, 5 mM MgCl₂

    • Substrate concentrations: 2 mM ADP, 5 mM Pi

    • Membrane potential generation: 5 mM NADH or 10 mM succinate with 5 μM rotenone

    • Temperature: 30-37°C (closer to physiological conditions)

    • Controls: Oligomycin-inhibited samples to determine ATP synthase-specific activity

  • Proton pumping assays:

    • pH indicators: ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine

    • Membrane preparation: SMPs (submitochondrial particles) or reconstituted proteoliposomes

    • Assay duration: Monitor for 5-10 minutes to capture both initial rates and steady-state

  • ATPase activity measurements:

    • Coupled enzyme assays with phosphoenolpyruvate, pyruvate kinase, and lactate dehydrogenase

    • NADH oxidation monitored at 340 nm

    • Controls for non-specific ATPase activity using specific inhibitors

The methodological approach should include rigorous statistical analysis, typically comparing at least 3-5 independent preparations with appropriate controls. Based on published research with similar proteins, ATP synthesis rates typically range from 200-600 nmol/min/mg protein in wild-type samples, with mutant variants showing 30-80% reductions depending on the severity of the mutation .

How can researchers effectively compare experimental data from Pan troglodytes MT-ATP6 with human clinical findings?

Effective comparative analysis requires:

  • Standardized assay conditions:

    • Use identical biochemical assay conditions when comparing data

    • Normalize results to appropriate internal controls

    • Express results as percentage of wild-type activity to facilitate cross-species comparison

  • Residue mapping and structural alignment:

    • Create detailed alignments of Pan troglodytes and human MT-ATP6 sequences

    • Map corresponding residues in 3D structural models

    • Focus on conserved functional domains and residues

  • Functional correlation approaches:

    • Develop regression models correlating biochemical deficits with clinical severity

    • Use statistical methods appropriate for small sample sizes

    • Consider multiple parameters simultaneously (ATP synthesis, assembly, stability)

  • Translation to clinical relevance:

    • Match molecular phenotypes to human disease presentations

    • Consider tissue-specific effects and energy thresholds

    • Validate findings with patient-derived samples when available

Studies of MT-ATP6 variants have demonstrated that significant functional defects in experimental models (>50% reduction in ATP synthesis) generally correlate with clinical disease, while variants with minimal effects (<20% reduction) are less likely to be disease-causing . The correlation approach should include both binary assessment (pathogenic/non-pathogenic) and quantitative correlation with disease severity.

What quality control metrics ensure reproducibility in MT-ATP6 research?

Ensuring reproducibility requires rigorous quality control:

  • Protein quality metrics:

    • Purity: >90% by SDS-PAGE and mass spectrometry

    • Integrity: Western blot using antibodies against specific epitopes

    • Folding: Circular dichroism to confirm secondary structure

    • Homogeneity: Dynamic light scattering to assess aggregation state

  • Functional validation:

    • Activity benchmarks: Compare ATP synthesis rates to established standards

    • Inhibitor sensitivity: Proper response to specific inhibitors (oligomycin, DCCD)

    • Proton gradient formation: Membrane potential measurements

  • Statistical and reporting requirements:

    • Minimum of three biological replicates

    • Appropriate statistical tests with p-values

    • Effect sizes and confidence intervals

    • Complete reporting of experimental conditions

  • Validation across systems:

    • Compare results between different expression systems

    • Test in multiple functional assays (ATP synthesis, hydrolysis, proton pumping)

    • Verify key findings in more complex models when possible

What emerging techniques might revolutionize our understanding of MT-ATP6 structure and function?

Several cutting-edge approaches show promise:

  • Cryo-electron tomography (cryo-ET): Enables visualization of ATP synthase in its native membrane environment, revealing supramolecular organization that may influence function.

  • AlphaFold2 and other AI-based structural prediction: Increasingly accurate for membrane proteins, providing structural insights for regions challenging to resolve experimentally.

  • Genome editing technologies:

    • Base editing for precise mtDNA modification

    • CRISPR-free approaches for mitochondrial genome editing

    • Heteroplasmy shifting technologies

  • Single-molecule biophysics:

    • High-speed AFM to observe conformational dynamics in real-time

    • Magnetic tweezers to measure torque generation during ATP synthesis

    • Zero-mode waveguides for single-molecule fluorescence

  • Advanced computational approaches:

    • Quantum mechanical/molecular mechanical (QM/MM) simulations of proton transfer

    • Machine learning integration with experimental data for mechanism prediction

These emerging technologies will likely provide unprecedented insights into the proton translocation mechanism, rotary catalysis dynamics, and the molecular basis of disease-causing mutations. Recent advances in cryo-EM have already revolutionized our understanding of ATP synthase structure, revealing the architecture of the membrane region and the path of proton translocation .

How might Pan troglodytes MT-ATP6 research contribute to therapeutic development for human mitochondrial diseases?

Therapeutic development applications include:

  • Drug screening platforms:

    • Recombinant Pan troglodytes MT-ATP6 can serve as a platform for high-throughput screening of compounds that modulate ATP synthase function

    • The high homology with human protein makes it a relevant model for drug discovery

  • Precision medicine approaches:

    • Structure-function relationships revealed in Pan troglodytes MT-ATP6 can inform mutation-specific interventions

    • Heteroplasmy modulation strategies can be tested in relevant model systems

  • Gene therapy strategies:

    • Allotopic expression (nuclear expression of mitochondrial genes)

    • RNA import approaches for functional complementation

    • Mitochondria-targeted nucleases for heteroplasmy shifting

  • Metabolic bypass strategies:

    • Identifying alternate energy production pathways

    • Metabolic modifiers that increase ATP production through other mechanisms

    • Compounds that enhance residual ATP synthase function

  • Mitochondrial replacement therapy optimization:

    • Understanding species-specific ATP synthase properties can inform compatibility issues in mitochondrial replacement

Research on the mutations m.8950G>A, m.9025G>A, and m.9029A>G in MT-ATP6 has demonstrated significant functional consequences, making them targets for therapeutic intervention . The yeast model system provides a platform for screening compounds that might restore function to these compromised variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.