Recombinant Pan troglodytes C-X-C chemokine receptor type 2 (CXCR2)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

The recombinant protein is produced through:

  1. Gene synthesis: Full-length CXCR2 gene (NCBI Gene ID: 748989) codon-optimized for prokaryotic expression

  2. Expression: Induced in E. coli BL21(DE3) cells at 18°C

  3. Purification: Immobilized metal affinity chromatography (IMAC) followed by size-exclusion chromatography

Functional validation includes:

  • Calcium flux assays showing EC₅₀ = 2.22 nM for IL-8

  • Surface plasmon resonance confirming ligand binding kinetics

  • Neutrophil chemotaxis assays in transwell systems

Research Applications

Recombinant Pan troglodytes CXCR2 enables comparative studies of primate immune responses:

Table 2: Key research applications

ApplicationExperimental ModelFindings
Chemokine signalingHEK293 transfection Identified biased agonism mechanisms
Drug discoveryVirtual screening platforms Validated AZD5069 binding kinetics
Evolutionary immunologyPrimate PBMC assays Revealed species-specific migration thresholds

Recent studies demonstrate:

  • Immune cell engineering: CXCR2-transduced NK cells showed 3.2-fold increased tumor infiltration in xenograft models

  • Pathogen interaction studies: Identified cytomegalovirus vCXC-1 binding mechanisms

  • Therapeutic development: Enabled testing of inverse agonists like RCT001 (IC₅₀ = 42.7 nM)

Pathway Involvement

The receptor participates in critical inflammatory pathways:

Table 3: Key signaling pathways

PathwayDownstream EffectorsBiological Outcome
Chemokine signalingPI3K-Akt, MAPK/ERK Neutrophil activation & degranulation
Phospholipase DPLCβ → IP3/Ca²⁺ Chemotaxis signal amplification
JAK/STATSTAT3 phosphorylation Tumor microenvironment remodeling

Clinical Relevance

While direct clinical data for Pan troglodytes CXCR2 is limited, human homolog studies reveal:

  • Cancer biology: CXCR2+ tumors show 2.4-fold increased metastasis risk (HR = 1.89, p=0.002)

  • Inflammatory diseases: CXCR2 inhibition reduces neutrophil infiltration by 68% in sepsis models

  • Therapeutic targeting: Dual CXCR2/PD-1 blockade increases progression-free survival from 4.6 to 11.2 months in RCC

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
CXCR2; IL8RB; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Pan troglodytes (Chimpanzee)
Target Names
Target Protein Sequence
FNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSL LGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVS LLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLF RRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHM GQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILG ILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Uniprot No.

Target Background

Function

CXCR2 is a receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor. IL-8 binding to CXCR2 activates neutrophils through a G-protein-mediated pathway, triggering a phosphatidylinositol-calcium second messenger system. This receptor binds IL-8 with high affinity, and also exhibits high affinity binding to CXCL3, GRO/MGSA, and NAP-2.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CXCR2 and what are its primary functions in Pan troglodytes?

CXCR2 (C-X-C motif chemokine receptor 2), also known as interleukin-8 receptor β (IL8RB) or CD182, is a G protein-coupled receptor (GPCR) that binds ELR+ CXC chemokines, particularly IL-8 (CXCL8) and growth-regulated oncogene-α (GROα/CXCL1). In Pan troglodytes, as in humans, CXCR2 primarily mediates neutrophil chemotaxis, angiogenesis, and inflammatory responses through activation of Gαi-mediated pathways. These pathways trigger downstream MAPK, PI3K/AKT, and β-arrestin signaling cascades that regulate cellular migration, proliferation, and immune function . The receptor plays critical roles in both physiological immune responses and pathological conditions involving inflammation.

What experimental models are available for studying CXCR2 function?

Several experimental models have been developed for investigating CXCR2 function:

  • Genetic knockout models: CXCR2 knockout mice (CXCR2−/−) exhibit neutrophilia and impaired neutrophil recruitment during acute inflammatory conditions . These models are valuable for studying the role of CXCR2 in vivo.

  • Cell-based assays: Neutrophil chemotaxis assays using recombinant CXCR2 proteins or CXCR2-expressing cell lines provide insights into receptor-ligand interactions and signaling mechanisms .

  • Disease models: Various inflammation models including experimental autoimmune encephalomyelitis, chronic post-surgical pain models, and cuprizone-induced demyelination have been used to study CXCR2 function in pathological contexts .

  • Pharmacological inhibition: CXCR2 inhibitors like SB225002 can be used to study receptor function through selective antagonism in both in vitro and in vivo systems .

These models collectively enable multifaceted investigation of CXCR2 biology across different physiological and pathological contexts.

How can researchers validate the functional activity of recombinant Pan troglodytes CXCR2?

Validation of recombinant Pan troglodytes CXCR2 functional activity requires multiple complementary approaches:

  • Ligand binding assays: Measure binding affinity of known CXCR2 ligands (IL-8/CXCL8, GROα/CXCL1) to the recombinant receptor using techniques such as surface plasmon resonance or radioligand binding.

  • Calcium flux assays: Since CXCR2 activation triggers calcium mobilization, intracellular calcium measurements using fluorescent indicators can assess receptor functionality.

  • Migration assays: Chemotaxis assays using neutrophils or transfected cell lines expressing the recombinant receptor can demonstrate functional response to chemokine gradients .

  • Signaling cascade activation: Western blot analysis of phosphorylated ERK, AKT, and other downstream targets after ligand stimulation confirms signal transduction capacity .

  • Competitive inhibition studies: Testing known CXCR2 antagonists (e.g., SB225002) to block activity can further validate receptor specificity and function .

Each validation approach should include appropriate positive and negative controls, and results should be benchmarked against human CXCR2 to identify any species-specific functional differences.

How does CXCR2 signaling differ between peripheral and central nervous system environments?

Research indicates significant functional differences in CXCR2 signaling between peripheral tissues and the central nervous system (CNS). In CXCR2−/− mice, distinct phenotypes are observed depending on the anatomical context. In peripheral tissues, CXCR2 knockout leads to neutrophilia and impaired neutrophil recruitment during acute inflammation, yet these mice maintain functions required for peripheral bacterial clearance .

In contrast, within the CNS, CXCR2 appears to regulate selective neutrophil effector functions critical for pathological processes such as demyelination. Studies using the cuprizone-induced demyelination model demonstrated that CXCR2-positive neutrophils were required for extensive demyelination in the corpus callosum of wild-type mice, while CXCR2−/− mice showed resistance to demyelination . This suggests that CXCR2 exerts varying effector functions in acute versus chronic inflammatory reactions, as well as between peripheral and CNS environments.

Additionally, knockout studies indicate CXCR2 controls the positioning of oligodendrocyte precursors in the developing spinal cord by arresting their migration, highlighting its importance in CNS development beyond inflammatory responses . These differential functions have significant implications for therapeutic targeting of CXCR2 in neurological versus peripheral inflammatory conditions.

What role does CXCR2 play in chronic post-surgical pain mechanisms?

Recent research has identified CXCR2 as a potential therapeutic target for chronic post-surgical pain (CPSP). In rat models of CPSP using skin/muscle incision and retraction (SMIR), increased CXCR2 expression was observed compared to control animals. The CPSP model showed significantly reduced paw withdrawal threshold (PWT), indicating mechanical allodynia, alongside elevated levels of inflammatory markers Iba1 (microglial marker), IL-1α, and TNF-α .

Administration of the CXCR2 inhibitor SB225002 reversed these effects, suggesting CXCR2 involvement in CPSP pathogenesis. Mechanistically, CXCR2 appears to function through the JAK1/STAT3 signaling pathway to promote cell proliferation and inflammatory responses that contribute to pain sensitization. Gene ontology (GO) and KEGG pathway enrichment analyses revealed that downregulation of CXCR2 expression decreases levels of EPAC1 (exchange protein directly activated by cAMP 1), suppressing cell proliferation and immune responses .

These findings suggest a potential therapeutic pathway where inhibiting CXCR2 could alleviate CPSP by modulating neuroimmune interactions. This represents an important new direction for pain research, particularly given the lack of effective treatments for chronic post-surgical pain conditions.

What are the key technical challenges in expressing and purifying functional recombinant Pan troglodytes CXCR2?

Expressing and purifying functional G protein-coupled receptors (GPCRs) like CXCR2 presents several technical challenges:

  • Membrane protein solubility: As a seven-transmembrane receptor, CXCR2 is highly hydrophobic and difficult to maintain in a functional conformation during extraction and purification. Researchers should optimize detergent selection (e.g., n-dodecyl-β-D-maltopyranoside or digitonin) and consider nanodiscs or other membrane-mimetic systems.

  • Expression systems: While bacterial systems offer high yield, they often fail to properly fold GPCRs. Mammalian, insect, or yeast expression systems generally provide better functional expression for Pan troglodytes CXCR2, with each having specific advantages and limitations for post-translational modifications.

  • Protein stability: CXCR2 tends to aggregate or denature during purification. Consider using stabilizing ligands during purification, thermostabilizing mutations, or fusion partners (T4 lysozyme or BRIL) that have been successful for other GPCRs.

  • Functional validation: Standard biochemical assays may not adequately assess CXCR2 functionality. Combining structural analysis (circular dichroism, tryptophan fluorescence) with functional assays (ligand binding, G-protein coupling) provides more comprehensive validation .

  • Species-specific considerations: While highly conserved, subtle differences between human and chimpanzee CXCR2 may affect expression, folding, or ligand interactions, requiring species-specific optimization of expression conditions.

How can researchers differentiate between CXCR1 and CXCR2 signaling in experimental systems?

Differentiating between CXCR1 and CXCR2 signaling requires selective approaches given their overlapping ligand recognition and signaling pathways:

  • Selective ligands: Utilize chemokines that preferentially bind CXCR2 (GROα/CXCL1, GROβ/CXCL2, GROγ/CXCL3) versus those that bind both receptors (IL-8/CXCL8). Concentration-dependent studies can exploit affinity differences.

  • Receptor-specific antagonists: SB225002 is relatively selective for CXCR2 over CXCR1 and can be used to pharmacologically isolate CXCR2-mediated effects .

  • Receptor-selective antibodies: Epitope-guided antibody selection can yield highly specific antibodies that selectively target CXCR2. For example, antibodies targeting the N-terminal region where CXCR1 and CXCR2 share only 25% homology can provide selectivity .

  • siRNA or CRISPR approaches: Selective knockdown or knockout of CXCR1 or CXCR2 in cell culture systems allows for isolation of receptor-specific effects.

  • Biased signaling analysis: CXCR1 and CXCR2 may differ in their signaling bias (G-protein vs. β-arrestin pathways). Phosphorylation assays for different downstream targets can help differentiate receptor activation.

  • Receptor expression systems: Heterologous expression of either receptor alone provides clean systems for studying receptor-specific signaling without interference.

When using any of these approaches, it's essential to include appropriate controls and validate findings using multiple complementary methods.

What are the significant genetic differences between Pan troglodytes ellioti and other chimpanzee subspecies that might impact CXCR2 function?

Pan troglodytes ellioti has been confirmed as a genetically distinct chimpanzee population through comprehensive SNP analysis. Research utilizing approximately 700 autosomal SNPs derived from genomic data demonstrates clear differentiation between P. t. verus, P. t. troglodytes, and P. t. ellioti populations at both SNP and haplotype levels, with genetic distinctions greater than those separating continental human populations .

While the search results don't specifically address CXCR2 genetic variation across chimpanzee subspecies, this broader genetic differentiation suggests potential subspecies-specific variations in immune-related genes including chemokine receptors. Given CXCR2's important role in immune function and the selective pressures on immune genes during evolution, researchers working with Pan troglodytes CXCR2 should consider:

  • Subspecies origin of their biological samples or recombinant proteins

  • Potential functional consequences of subspecies-specific genetic variants

  • Comparative analyses across subspecies when making evolutionary or functional claims

Notably, analysis based solely on mitochondrial DNA was found to be erroneous in 4 of 54 chimpanzee cases, reinforcing the importance of using multiple genetic markers for population classification and highlighting the complex demographic history of chimpanzee populations . These findings have significant implications for both conservation strategies and our understanding of chemokine receptor evolution.

How do therapeutic approaches targeting CXCR2 differ between humans and animal models?

Therapeutic approaches targeting CXCR2 show important differences between human applications and animal models:

  • Pharmacokinetic/pharmacodynamic variations: Due to species differences in receptor binding sites, drug metabolism, and distribution, CXCR2 antagonists may show variable efficacy and safety profiles between humans and animal models. For example, while the CXCR2 inhibitor SB225002 shows efficacy in rat models of chronic post-surgical pain , human trials of CXCR2 antagonists require careful dose optimization.

  • Target specificity challenges: Species-specific differences in the extracellular domains of CXCR2 can affect the binding of therapeutic antibodies. Antibodies developed against human CXCR2 may need modification for use in animal studies, particularly for epitopes in the N-terminal region where variability is higher .

  • Clinical translation considerations: While CXCR2 antagonists and antibodies have shown promising results in animal models for conditions like experimental autoimmune encephalomyelitis and chronic post-surgical pain , human trials face additional challenges including:

    • Potential immunosuppressive effects, particularly neutropenia

    • Balancing therapeutic efficacy with side effects

    • Individual variation in receptor expression and function

  • Emerging biased signaling approaches: Recent research explores biased signaling modulation to dissociate anti-inflammatory benefits from adverse effects . These approaches may have different efficacy profiles across species due to subtle differences in signaling pathway coupling.

Researchers should consider these species differences when designing studies and interpreting results, particularly when using Pan troglodytes CXCR2 as a model for human therapeutic development.

What validated tools and reagents are available for Pan troglodytes CXCR2 research?

Reagent TypeProduct ExampleSourceValidated ApplicationsNotes
Recombinant ProteinRecombinant Pan troglodytes C-X-C chemokine receptor type 2 (CXCR2)CSB-CF631729EQVBinding assays, Functional studiesPartial sequence available
Antibodies (cross-reactive)CXCR2 AntibodyCSB-PA011673HA01HUIHC, IFValidated on human tissues, may cross-react with Pan troglodytes
InhibitorsSB225002Various commercial sourcesIn vitro and in vivo functional studiesSelective CXCR2 antagonist used in multiple model systems
Genetic modelsCXCR2−/− miceGenerated since 1994In vivo pathophysiological studiesShows neutrophilia and impaired neutrophil recruitment
Expression vectorspCMV-CXCR2 constructsVarious academic sourcesHeterologous expression systemsOften requires species-specific optimization

This table represents a starting point for researchers, and reagent selection should be based on specific experimental requirements and validation for Pan troglodytes systems.

What are the key experimental readouts for assessing CXCR2 function in different model systems?

Model SystemKey ReadoutsMethodologySignificanceReference
Cell-based assaysCalcium fluxFluorescent calcium indicatorsMeasures immediate receptor activation
Cell-based assaysChemotaxisTranswell migration assaysQuantifies functional chemotactic response
Cell-based assaysERK/AKT phosphorylationWestern blot, ELISAMeasures downstream signaling cascade activation
In vivo inflammationNeutrophil infiltrationFlow cytometry (Ly6G+/CD45+)Assesses in vivo recruitment capacity
In vivo pain modelsPaw withdrawal threshold (PWT)von Frey filamentsMeasures mechanical allodynia in pain models
In vivo neuroinflammationDemyelination extentHistopathologyAssesses CXCR2-mediated tissue damage
In vivo neuroinflammationInflammatory cytokinesELISA (IL-1α, TNF-α)Quantifies inflammatory cascade activation
In vivo signalingJAK1/STAT3 pathway activationPhosphorylation assaysLinks receptor activation to specific signaling

How might targeting CXCR2 signaling in Pan troglodytes models advance our understanding of human inflammatory diseases?

Studying CXCR2 signaling in Pan troglodytes models offers unique advantages for understanding human inflammatory diseases due to the high genetic and physiological similarity between chimpanzees and humans. Future research in this area could focus on:

  • Comparative receptor biology: Detailed structural and functional comparisons between human and chimpanzee CXCR2 could reveal subtle evolutionary adaptations in immune responses. These insights might explain differential susceptibility to inflammatory diseases between species.

  • Biased signaling investigation: Pan troglodytes models could help identify species-specific differences in how CXCR2 couples to various downstream pathways. Recent research suggests modulating biased signaling might dissociate anti-inflammatory benefits from adverse effects like neutropenia .

  • Neuroinflammatory disease mechanisms: Given CXCR2's role in demyelination and oligodendrocyte precursor cell positioning , comparative studies could illuminate evolutionary differences in neuroimmune interactions relevant to multiple sclerosis and other demyelinating disorders.

  • Therapeutic antibody development: The epitope-guided antibody approach that yielded highly selective antibodies against human CXCR2 could be applied to Pan troglodytes CXCR2, potentially revealing conserved epitopes ideal for cross-species therapeutic development .

  • Pain pathway evolution: Since CXCR2 has been implicated in chronic post-surgical pain through JAK1/STAT3 signaling , comparative studies could reveal evolutionary conservation of pain pathways, potentially identifying novel therapeutic targets.

These approaches could significantly advance our understanding of how inflammatory mechanisms evolved and identify more effective therapeutic strategies for inflammatory conditions with fewer side effects.

What emerging technologies might enhance our ability to study CXCR2 signaling dynamics?

Several cutting-edge technologies show promise for advancing CXCR2 research:

  • Cryo-electron microscopy (cryo-EM): This technique could resolve the structure of Pan troglodytes CXCR2 in complex with various ligands and signaling partners, providing insights into species-specific conformational dynamics and potential drug binding sites.

  • CRISPR/Cas9 genome editing: Creating precise knock-in models with species-specific CXCR2 variants could help delineate the functional consequences of evolutionary changes between human and chimpanzee CXCR2.

  • Single-cell RNA sequencing: This approach could characterize cell type-specific CXCR2 expression patterns and downstream effects across different tissues and disease states, revealing nuanced regulatory networks.

  • Nanobody technology: Developing nanobodies against specific CXCR2 conformational states could provide unique tools for studying receptor activation dynamics and potentially lead to highly selective therapeutics.

  • Biosensors and real-time imaging: FRET-based biosensors for CXCR2 activation and signaling could enable live-cell visualization of receptor dynamics with unprecedented temporal and spatial resolution.

  • Bioinformatic approaches: Advanced computational modeling integrating evolutionary, structural, and functional data could predict species-specific differences in CXCR2 function and guide experimental design.

  • Organoid systems: Developing immune organoids incorporating Pan troglodytes cells expressing CXCR2 could provide more physiologically relevant models for studying receptor function in complex tissue environments.

These technologies could collectively transform our understanding of CXCR2 biology and accelerate therapeutic development for CXCR2-related disorders such as inflammatory diseases, chronic pain conditions, and certain cancers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.